KEGG   Haloarcula marismortui: rrnAC2436Help
Entry
rrnAC2436         CDS       T00211                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hma  Haloarcula marismortui
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:hma00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2178385..2179158
Genome map
AA seq 257 aa AA seqDB search
MEVFAVEGVPEVRPGDDVAELLVEQADLQDDDVVCVASTIVSKANGRGRSLSSYEPSGRA
ERIAATIEDIADEEKDPRMAQAILDECEEVLVEAPFILGVTKFGHITVNAGIDRSNVPGA
DLLLLPEDPTAEAEAIRDGIREHAGVEPSVIVTDTSGRPFRLGQRGVALGWAGLSASRDW
RGEHDRDGRELEATVQAVVDELAAAANLVTGEGDGGTPAAVVRDFDFGDHAGSEQLFRDP
EKDVVRQALREWSHVRD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcttcgcggtcgagggggtgcccgaggtccgccctggcgatgatgtggccgaa
ctgctcgtcgagcaggccgacctgcaggacgacgacgtagtctgtgtcgccagcaccatc
gtttccaaggccaacggacgcgggcggtcgctgtcatcgtacgagccaagcgggcgtgct
gagcgcattgcggcaaccatcgaagacatcgccgacgaggagaaagacccgcggatggca
caggcgattctcgacgagtgcgaggaggtgctggtcgaagcccccttcatcctcggcgtg
acgaagttcgggcatatcaccgtcaacgcgggcatcgaccgctcgaacgtgcccggcgcg
gaccttctcttgctccccgaggacccgacggcagaggccgaagcgatccgcgacggcatc
cgcgaacacgcgggagtcgaacccagcgtcatcgttaccgacacgtcggggcggccgttt
cgcctcggccagcgcggcgtcgcgctaggctgggccgggctctccgcctcgcgggactgg
cggggcgaacacgaccgcgacggccgcgaactcgaagccaccgttcaggccgtcgttgac
gaactcgccgccgcagccaacctcgtcaccggcgaaggcgacggcggaacacccgccgca
gtcgtccgcgatttcgacttcggcgaccacgcgggcagcgagcagctgttccgcgacccg
gagaaggacgtagtcagacaagcactcagagagtggtcccatgtacgcgattga

DBGET integrated database retrieval system