KEGG   Haloarcula marismortui: rrnAC2515Help
Entry
rrnAC2515         CDS       T00211                                 

Gene name
thrC4
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    rrnAC2515 (thrC4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    rrnAC2515 (thrC4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    rrnAC2515 (thrC4)
Enzymes [BR:hma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     rrnAC2515 (thrC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2246063..2247133
Genome map
AA seq 356 aa AA seqDB search
MRTCSVCDREYPRAEPWRCSCGAPLDYAMQPLPDSQPGQFSRTSGVWDFAKFLPMDERVS
LGEGWTPLVDAPGWDATFKLESLHPTGSFKDRGAATVIAEALEVGADRVLEDSSGNAGLA
VASYAARAGLDAEIYVPASAKDAKVRRIERTGADVVRVEGSRESVTEACIDAVEDGAGWY
ASHAWNPAFFAGTATAAYEIAAQRDWSVPDAVVTPLGHGTLFLGLYRGFQALEQAGWTDA
IPRILGTQAVGYSPIADDDEGGTVPDDAAANDLADGIHIRDPPRGRQIRHAIDETDGAAV
AVSAAATERERDRLGAAGFHVEPTCATATAALPEFRERGELQDGDDVVVALTGRND
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacctgtagcgtctgcgaccgggagtatccgcgtgcggaaccctggcggtgttct
tgcggagcaccgcttgactacgccatgcagccgctgcccgacagccaaccggggcagttc
tcacggaccagcggcgtctgggacttcgccaagttcctcccgatggacgagcgagtcagt
ctcggcgaaggctggacaccgctggtcgacgcgcccgggtgggacgccacgttcaaactg
gaatcactccacccgacggggagtttcaaggaccgcggcgcggcgacagttatcgccgaa
gcgctcgaagttggggccgaccgcgtgctcgaagactcctcgggcaacgccgggttggcg
gtcgcatcctacgcggcgcgagcggggctggacgcggagatatacgtccccgcgagcgcg
aaggacgcgaaggttcgccgcatcgaacgaaccggggccgatgtcgtccgggttgagggg
agtagagagtccgtaaccgaagcctgtatcgacgctgtggaggacggggcagggtggtat
gccagccacgcctggaatcccgctttcttcgccgggacagcgacggctgcctacgaaatc
gccgcccagcgtgactggagcgttccggacgccgtcgtcacgccgcttggtcacgggacg
ctgtttctcggtctctaccgtggatttcaggcgttggagcaagctggatggacagacgct
atcccgcgcatactgggaacgcaagcggtcgggtacagtcccatcgccgacgatgacgag
ggcgggactgtgccggacgacgctgccgccaacgacctcgccgacgggatccacatccgg
gacccaccacgcggccggcagatacggcacgctatcgacgagaccgatggtgccgccgtc
gccgtctccgcggcggcaacggagcgcgaacgcgaccggctcggtgcagcagggtttcac
gtcgagccgacgtgtgcgacggcgacagcggcgctacccgagttcagagagcggggagaa
ctccaggacggtgacgacgtcgttgtagcgttgaccgggcgaaacgattaa

DBGET integrated database retrieval system