KEGG   Haloarcula marismortui: rrnAC2522Help
Entry
rrnAC2522         CDS       T00211                                 

Gene name
manB3
Definition
(GenBank) phosphoglucomutase/phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma00030  Pentose phosphate pathway
hma00051  Fructose and mannose metabolism
hma00052  Galactose metabolism
hma00230  Purine metabolism
hma00500  Starch and sucrose metabolism
hma00520  Amino sugar and nucleotide sugar metabolism
hma00521  Streptomycin biosynthesis
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC2522 (manB3)
   00030 Pentose phosphate pathway
    rrnAC2522 (manB3)
   00051 Fructose and mannose metabolism
    rrnAC2522 (manB3)
   00052 Galactose metabolism
    rrnAC2522 (manB3)
   00500 Starch and sucrose metabolism
    rrnAC2522 (manB3)
   00520 Amino sugar and nucleotide sugar metabolism
    rrnAC2522 (manB3)
  Nucleotide metabolism
   00230 Purine metabolism
    rrnAC2522 (manB3)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    rrnAC2522 (manB3)
Enzymes [BR:hma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     rrnAC2522 (manB3)
    5.4.2.8  phosphomannomutase
     rrnAC2522 (manB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAV47325
UniProt: Q5UZH8
Position
I:2251249..2252628
Genome map
AA seq 459 aa AA seqDB search
MQVFGSSGVRGVAGDELTPRYVLRVAQAAGDVWRDDHDRVAIARDTRTTGRTFINAATSG
LTAVGFDVDRLGVVPTPGLQAYCEREAVPGVMITASHNPAAYNGVKLIGADGVELTRSTL
DRVEQSLRDDTPNYADWETVGSDTAIESARRRYREQVLAAVDRDRIADADLTIVVDSGHG
AGSLTSPDLFRELGCEVHTVNTQPDGHFPGRDPEPVAENLEDLRAFVRATDADLGFAHDG
DADRGMFVDETGTHIEGDAALAALAAAKIESGDGVVSAVNASQRLVDVVEDAGATLSLTP
IGSTYIVSRIRKLQNEGTHVAIAGEGNGGILFPDYRIARDGAFTAAKFLELVADRPASEV
AADYDDYYNVRRNLEYETEEERESMLEGIEAHANEATADLDTTDGYRLDYGDGWVLARPS
GTEPVVRVYAEARTLDRAEELAETMVSRATQQTNTYSGE
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgttcgggtcgagcggcgtccgaggtgtcgcgggcgatgagctgacaccgcgg
tacgtccttcgggttgcacaggccgccggggacgtctggcgtgacgaccacgaccgcgtg
gcgatcgcccgggacacgcggacgaccgggcggacgttcatcaacgccgcgacaagcggg
ctgacggccgtcgggttcgatgtcgaccgcctcggcgtcgtgccgacgccgggactgcag
gcctactgcgagcgtgaggcggtcccgggcgtaatgattactgcgagccacaatccggcc
gcgtacaacggcgtgaagctcatcggcgccgacggggttgaactgacacggagcacgctc
gaccgcgtcgagcagtcgctccgggacgacactccaaactacgcagactgggagacagtt
gggtcggacaccgccatcgagagcgcccgccgccgataccgcgagcaggtgcttgctgcc
gtcgaccgcgaccgaatcgccgacgccgacctcactatcgtcgtcgactccggccacgga
gctggctctcttacaagccccgacctgttccgcgaactcggctgtgaagtccacaccgtc
aacacccagcccgacggccacttccccggccgtgaccccgaacccgtcgccgagaacctc
gaagacctgcgggcgttcgtccgcgcgaccgacgccgacctcggttttgcccacgacggc
gacgccgaccgcgggatgttcgtcgacgagaccggaacacacatcgaaggtgacgccgcg
ctggccgcgctcgcggcggcgaaaatcgagtccggcgacggcgtcgtctcggcggtcaac
gcctctcagcgcctggtcgacgtggtcgaggacgccggcgcgaccctctcactgactcct
atcggctcgacgtacatcgtcagtcgcatccgcaaactgcaaaacgaggggacccacgtc
gcgattgccggcgaaggcaacggcggcattctctttcccgactaccgcatcgccagagac
ggcgcgttcaccgccgcgaagttcctcgaactcgtcgctgaccggcctgcaagcgaggtc
gccgcggactacgacgactactacaacgtccgtcggaacctcgaatacgagaccgaggaa
gagcgcgaatcaatgctcgaaggtatcgaggcccatgcgaacgaggcgacggccgacctc
gatacgacagacggctaccgcctcgactacggcgacggctgggtacttgctcgaccgtct
ggcacggagcccgtcgtccgggtctacgccgaagcgcgcacacttgaccgcgccgaggaa
ctcgccgaaacgatggtcagccgcgcgacccagcaaacgaatacttacagcggcgaatag

DBGET integrated database retrieval system