KEGG   Haloarcula marismortui: rrnAC2522Help
Entry
rrnAC2522         CDS       T00211                                 

Gene name
manB3
Definition
phosphoglucomutase/phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC2522 (manB3)
   00030 Pentose phosphate pathway
    rrnAC2522 (manB3)
   00051 Fructose and mannose metabolism
    rrnAC2522 (manB3)
   00052 Galactose metabolism
    rrnAC2522 (manB3)
   00500 Starch and sucrose metabolism
    rrnAC2522 (manB3)
   00520 Amino sugar and nucleotide sugar metabolism
    rrnAC2522 (manB3)
  Nucleotide metabolism
   00230 Purine metabolism
    rrnAC2522 (manB3)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    rrnAC2522 (manB3)
Enzymes [BR:hma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     rrnAC2522 (manB3)
    5.4.2.8  phosphomannomutase
     rrnAC2522 (manB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2251249..2252628
Genome map
AA seq 459 aa AA seqDB search
MQVFGSSGVRGVAGDELTPRYVLRVAQAAGDVWRDDHDRVAIARDTRTTGRTFINAATSG
LTAVGFDVDRLGVVPTPGLQAYCEREAVPGVMITASHNPAAYNGVKLIGADGVELTRSTL
DRVEQSLRDDTPNYADWETVGSDTAIESARRRYREQVLAAVDRDRIADADLTIVVDSGHG
AGSLTSPDLFRELGCEVHTVNTQPDGHFPGRDPEPVAENLEDLRAFVRATDADLGFAHDG
DADRGMFVDETGTHIEGDAALAALAAAKIESGDGVVSAVNASQRLVDVVEDAGATLSLTP
IGSTYIVSRIRKLQNEGTHVAIAGEGNGGILFPDYRIARDGAFTAAKFLELVADRPASEV
AADYDDYYNVRRNLEYETEEERESMLEGIEAHANEATADLDTTDGYRLDYGDGWVLARPS
GTEPVVRVYAEARTLDRAEELAETMVSRATQQTNTYSGE
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgttcgggtcgagcggcgtccgaggtgtcgcgggcgatgagctgacaccgcgg
tacgtccttcgggttgcacaggccgccggggacgtctggcgtgacgaccacgaccgcgtg
gcgatcgcccgggacacgcggacgaccgggcggacgttcatcaacgccgcgacaagcggg
ctgacggccgtcgggttcgatgtcgaccgcctcggcgtcgtgccgacgccgggactgcag
gcctactgcgagcgtgaggcggtcccgggcgtaatgattactgcgagccacaatccggcc
gcgtacaacggcgtgaagctcatcggcgccgacggggttgaactgacacggagcacgctc
gaccgcgtcgagcagtcgctccgggacgacactccaaactacgcagactgggagacagtt
gggtcggacaccgccatcgagagcgcccgccgccgataccgcgagcaggtgcttgctgcc
gtcgaccgcgaccgaatcgccgacgccgacctcactatcgtcgtcgactccggccacgga
gctggctctcttacaagccccgacctgttccgcgaactcggctgtgaagtccacaccgtc
aacacccagcccgacggccacttccccggccgtgaccccgaacccgtcgccgagaacctc
gaagacctgcgggcgttcgtccgcgcgaccgacgccgacctcggttttgcccacgacggc
gacgccgaccgcgggatgttcgtcgacgagaccggaacacacatcgaaggtgacgccgcg
ctggccgcgctcgcggcggcgaaaatcgagtccggcgacggcgtcgtctcggcggtcaac
gcctctcagcgcctggtcgacgtggtcgaggacgccggcgcgaccctctcactgactcct
atcggctcgacgtacatcgtcagtcgcatccgcaaactgcaaaacgaggggacccacgtc
gcgattgccggcgaaggcaacggcggcattctctttcccgactaccgcatcgccagagac
ggcgcgttcaccgccgcgaagttcctcgaactcgtcgctgaccggcctgcaagcgaggtc
gccgcggactacgacgactactacaacgtccgtcggaacctcgaatacgagaccgaggaa
gagcgcgaatcaatgctcgaaggtatcgaggcccatgcgaacgaggcgacggccgacctc
gatacgacagacggctaccgcctcgactacggcgacggctgggtacttgctcgaccgtct
ggcacggagcccgtcgtccgggtctacgccgaagcgcgcacacttgaccgcgccgaggaa
ctcgccgaaacgatggtcagccgcgcgacccagcaaacgaatacttacagcggcgaatag

DBGET integrated database retrieval system