KEGG   Haloarcula marismortui: rrnAC2667Help
Entry
rrnAC2667         CDS       T00211                                 

Gene name
thrC3
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    rrnAC2667 (thrC3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    rrnAC2667 (thrC3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    rrnAC2667 (thrC3)
Enzymes [BR:hma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     rrnAC2667 (thrC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2375908..2377299)
Genome map
AA seq 463 aa AA seqDB search
MVPTMADLQLTDDVPPVADDGVWLACIECGETFAPFDEIRYTCDHCDGLLEVRYDDLPTF
DEFEGSGVWRYNAALPFEEGITLPEGDTPLHEMPRLKDDIGVDALRVKHEGMNPTGSFKD
RGMTVGVRVAQEVGVDRLACASTGNTSAALAAYGARGGMETLVLLPAGKVAAGKIAQASL
HRARILEVDGNFDQCLDIVQDLAARGEAYLLNSLNPFRLEGQKTIGLEIMEEFYADNGEY
PDRIVLPVGNAGNTAALYKCFRELVKAGAITEEQVPKLTGVQAEGAAPMVEAIENGYEDT
RRWDDVETRATAIRIGNPVNAPKALPGIRETGGTAVAVSDEEITEAQRDIAGEGVGVEPA
SAASVAGLRKLRREGEVDSDESVVCLTTGHLLKDPEAAAEAGNEPEPVANSTEAVLDLIE
EPSSVTETIRRQASKAADAPLVPALVASGLGVAYLYRKLRSKK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtcccgacaatggctgacctgcaactcaccgacgacgtgccgccggttgccgatgac
ggcgtctggctggcctgcatcgagtgtggtgagacgttcgctcccttcgacgagattcgc
tacacctgcgaccattgcgacggcctgctcgaggtccgctacgatgacctgccgaccttc
gacgagttcgaaggctcgggggtctggcggtacaacgctgccctgcccttcgaagagggt
atcacgctccccgagggtgacacgccgctgcacgagatgccccgcctgaaagacgacatc
ggcgtcgacgcgctccgcgtgaaacacgaggggatgaaccccactggctcgttcaaggac
cgcggcatgaccgtcggtgtccgggtcgcccaagaggtcggcgtcgaccgactggcctgt
gcctcgacgggcaacacgtctgcggcactggcggcttacggcgctcgcggcgggatggaa
acgctcgtgctcctgcctgccgggaaggtcgcagccggtaaaatcgctcaggcaagtctc
caccgcgcgcgcattctcgaagtcgacggcaacttcgatcagtgtctcgacatcgtgcag
gacctcgccgcccgcggcgaggcctacctcctgaactcgctgaaccccttccgtctggag
ggccagaagaccatcgggctggaaatcatggaggagttctacgccgacaacggcgagtac
ccggaccgaatcgtcctgccggtcggcaacgccggcaacaccgcggcgctgtacaagtgc
ttccgcgaactcgtcaaggccggcgcaatcaccgaggagcaggtgcccaaactcaccggc
gtgcaggcagagggtgccgctccgatggtcgaggctatcgagaatggatacgaggacacc
cgccgctgggatgacgtcgagacccgcgcgaccgccatccgcatcggcaatccggtcaac
gcgccgaaggcgctgccgggcatccgggagaccggcggcaccgccgtcgctgtctccgac
gaggaaatcaccgaagcgcagcgtgacatcgccggggaaggcgtcggcgtcgaaccggcg
tccgccgcctccgtcgctggcctccggaaactccggcgcgaaggcgaggtcgatagcgat
gagtcggtcgtctgcctgaccacgggccacctgctcaaagaccccgaagcggccgcagag
gccgggaacgagccggagccggtcgctaacagcaccgaagccgtgctggacctcatcgaa
gaaccgtcgtcagtcactgagacgattcggcgacaggcgtcgaaggccgccgacgcgccg
ctggtcccggcgctggtcgccagcggtctcggtgtcgcgtatctctaccgcaaactccgc
tcgaagaagtaa

DBGET integrated database retrieval system