KEGG   Haloarcula marismortui: rrnAC2781Help
Entry
rrnAC2781         CDS       T00211                                 

Gene name
pap2a
Definition
glucose-6-phosphatase (EC:3.1.3.9)
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2475929..2476639)
Genome map
AA seq 236 aa AA seqDB search
MLVALLAVGVALVVSLKGVFALPRPPGAGTATHAELLPAALRGVYESMATGEGFGFPSGH
ATLSLLVWGGIAWALRVGTRRQRTAVAATIVALIGLSRLVLGVHYLADIVAGFAIAGTAL
VLALSALKTPERVFGFAAVIAVAGLFVTGISRNSAGALGVAVAGAVVWALLGDSIPEPTR
HGVGITALLGVVSVGTLLGVTFELDPTPGVITLLAGLGTGVLLTLPLAGEQLAEKY
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggcactgctcgccgtcggcgtcgcgctcgtcgtgtcactgaaaggcgtgttc
gcgctgccacgaccgcccggggcgggcacggccacccacgccgaactgctcccggcggcg
ctgcggggcgtctatgagtcgatggcgaccggcgaagggtttggcttccccagtggccac
gccaccctttcgctgctcgtctggggcggtatcgcgtgggcgctccgggtcggcacgcgc
cgacagcgcaccgctgtcgccgcgacaatcgttgccctcatcgggctctcccggctagta
ctgggcgtccactacctcgccgacatcgtcgcgggctttgccatcgccgggacagccctc
gtactcgccctcagcgcactcaaaacgcccgagcgagtattcggcttcgcggccgtcatc
gccgtggcagggctgttcgtcaccggcatttcccgcaattcggccggcgcgctgggtgtc
gctgtcgcgggtgccgtggtctgggcgctcttaggagattcaatcccggaaccgacccgg
cacggtgtcggtatcacagcgctgctgggcgttgtctcggttggaacgttgctcggggtg
acgttcgagttagacccgacgccgggcgtcatcacgttacttgcggggcttgggaccggg
gtcctgctaacgctaccgctggccggtgagcaactcgcagaaaaatactga

DBGET integrated database retrieval system