KEGG   Haloarcula marismortui: rrnAC3018Help
Entry
rrnAC3018         CDS       T00211                                 

Gene name
hmcA
Definition
(GenBank) protporphyrin IX magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hma  Haloarcula marismortui
Pathway
hma00860  Porphyrin and chlorophyll metabolism
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    rrnAC3018 (hmcA)
Enzymes [BR:hma01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     rrnAC3018 (hmcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 MCM Sigma54_activat AAA_16
Motif
Other DBs
NCBI-ProteinID: AAV47743
UniProt: Q5UYB0
Position
I:complement(2672602..2674761)
Genome map
AA seq 719 aa AA seqDB search
MVVFVAGKKASQGPTFAAVVGQRDLKDGLLAVATDDDLDGLLVRGEKGTAKSTAVRALAD
LLPEQRAVADCPYGCPPDRPDEQCEDCRTRSDPPVETRSVPLVTLPLGATRDRVVGTLSV
ADALDGDHEFDPGLLARANRGILYVDEVNLLDDHLVDVLLDAAASGQNRVERDGVTVTHP
AEFTLVGTMNPEEGDLRPQLRDRFALQTEVSACEDLDDRVAIIDQALGESDDEERQTEPD
RGPGERLRTARDLLPEVDLAREFREQIAELCRDAGLDGHRGDIATARAARTFAALDGRTT
VLESDIERAAEFALPHRLTSRPFEDAPDVDDVLDDHFEDEEGEAEEESADDEESGEEGGD
ADSDEEAGAGDESVNDGADSEGSEDGSEQQEQRPDDSGESGEDGDDESGERGEQPTPASA
DSDGERQEAEAGDGEGAAGDDGGEGDPDQPDDPENATPLLPGQSRTAVGDSGAPDVDAPS
VDTDGGSASGRASATGTKRGATVRTERAGRDDEVDAAASVRAAASRGSGRVESRDLRKSV
RAGDAETLVVFAVDASASMRPAMKAAKGTVLELLKDAYQARDEVAFVTFAGEGADVVLPP
TDSVSLAARHLKDLPTGDRTPLPDGLTAACEVLDRADPDAGVVIVVTDGRANTADGSPVA
ATRTAARTLGEAATRTIVVNAGEAGRAGLLDLVAEETDASVVSLDALTAERVDAVASDQ
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggttgtattcgtcgcgggcaaaaaagcttcgcagggaccgacgttcgcggccgtcgtc
ggccagcgcgacctcaaggacggcctgctcgcggtcgcgacggacgacgacctcgacggc
ctgctggtccgcggcgagaaggggacagcgaagtcgacggcggtgcgcgcgcttgccgac
ctgctgcccgagcagcgcgcggtcgcggactgcccctacggctgtccgccagaccggccc
gacgagcaatgcgaggactgccggacacgctcagacccgccggtcgaaactcgttcggtt
ccactcgtgacgctccccctcggtgcgacccgggaccgcgtcgtcggcacgctgtcggtg
gccgacgcgctcgacggcgaccacgagttcgaccccggcctgctcgcccgcgcgaaccgc
ggcatcctctacgtggacgaggtgaatctgctcgacgaccatctcgtggacgtactcctc
gacgccgccgcgagcggccaaaaccgggtcgagcgcgatggcgtcaccgtcacccacccc
gccgagttcacgctcgtcgggacgatgaaccccgaagaaggcgacctgcgcccgcagttg
cgggaccgcttcgccctgcagactgaagtcagcgcctgcgaggaccttgacgaccgcgtt
gctatcattgaccaggcgctcggggaaagcgatgacgaggagaggcagaccgaaccggac
cgcggtccgggcgagcgcctgcggaccgcccgcgacctgctcccggaggtcgacctcgcc
cgcgagttccgcgaacagatcgccgaactctgtcgggacgccggcctcgacggccaccgc
ggcgatatcgctacagcgcgagcggcccggaccttcgctgcgctggacgggcggacgacg
gtactcgaatcagatatcgaacgcgccgccgagttcgcgctcccccaccggctcacctcc
cggcccttcgaggacgcgccggacgtggacgacgtgctcgacgaccatttcgaggacgag
gagggcgaggctgaggaggagtccgccgatgacgaagaaagcggtgaggaggggggtgac
gcggacagcgacgaggaagcgggggccggcgacgagtcagtaaacgacggagccgattcc
gaaggcagtgaggacggaagcgaacagcaggagcagcgcccggacgacagcggagaatcc
ggcgaggacggcgacgacgagtcaggcgagcgcggcgagcagccgacgcccgcttcggcc
gacagcgacggcgagcggcaggaagcagaggccggcgacggcgaaggagcggccggagac
gacggtggggagggcgaccccgaccaacccgacgaccccgaaaacgccaccccgctgctg
ccgggccagtcccgcaccgcagtcggcgacagcggcgcgcctgacgtggacgcaccatcg
gtcgacacagacggtgggagcgcaagcggccgtgcgagcgcgacagggacgaaacgcggt
gcaacggtccgaaccgagcgcgccggccgggacgatgaggtcgacgccgcagcgtcggtc
cgggcggcggccagtcgcgggagcggccgtgtcgagtcacgtgaccttcggaagtccgtt
cgtgcaggcgacgccgagacgctggtggtgttcgccgtcgacgcgagcgcgtcgatgcgc
ccggcgatgaaagccgcaaaaggcacagtactggaactgctgaaagacgcctatcaggcc
cgcgacgaagtcgcgttcgtcaccttcgccggcgagggcgcggacgtggtactcccgccc
actgacagcgtttcgctggcggcacgccacctgaaagacctccccacaggcgaccggaca
ccactgccggacgggctgacggccgcctgcgaagtgctcgaccgggcggacccggatgcc
ggcgtcgtcatcgtcgtaaccgacgggcgggcgaacaccgccgacgggagtccggtggca
gcgaccagaaccgcggcgcgaacgctcggtgaagcagccacccggactatcgtcgtgaat
gccggcgaagcgggccgtgctggattacttgacctcgttgcagaggaaacggacgcgtca
gtggtctcactggacgcgctgaccgcggagcgcgtcgatgccgtcgccagcgaccagtag

DBGET integrated database retrieval system