KEGG   Haloarcula marismortui: rrnAC3088Help
Entry
rrnAC3088         CDS       T00211                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hma  Haloarcula marismortui
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    rrnAC3088 (hemD)
Enzymes [BR:hma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     rrnAC3088 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2737602..2738384
Genome map
AA seq 260 aa AA seqDB search
MREEPRLRVAAFRPDDDRLDDAVELIESLGADPVPDPMLAIEPATADDAEATGRQVTPRS
DADYVVLTSKTGVELAAEAGWDAGEATVCAIGDSTAEALHEAGYGVDIIPAEYSSTGLVE
TLSGAVAGARVEVARSDHGSAVLTDGLEAAGAYVHETVLYRLVRPEGSGESAELAASGDL
DAALFTSSLTVEHFLDAAADLGLREAVIDGLNEATVAAIGQPTRETAEDAGISVDVVPDQ
ADFEALACEAIEAAAPTHHE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggaaccacgtctgcgcgtagccgctttccggcctgacgatgaccgcttagac
gatgcagtcgaactcatcgaatccctcggcgctgacccggttccggacccgatgcttgcg
atcgaaccggcgacggccgacgatgccgaggccaccggcaggcaagtcacgccccgttct
gacgccgactacgtcgtcctgacgagcaagaccggcgtcgaactcgccgccgaagccggc
tgggacgccggcgaggcgacggtatgtgctattggcgattcgaccgccgaggcgctccac
gaggccggctacggcgtcgacatcatccccgccgagtactcttcgacgggactcgtcgaa
acgctgtccggagcggtggccggcgcaagggtcgaagtcgcccggtcggaccacggctcc
gcggtgctaactgacggactggaggccgctggtgcatacgtccacgaaaccgtgctgtac
cggctggtccgtccggaaggctcgggcgagtccgcggagctggccgcaagcggggacctc
gacgcggcgctgttcacgtcatcgctcacggtcgaacacttcctcgatgcggctgcggac
ctcggtctccgcgaggctgtcatcgacggactgaacgaggcaactgtcgccgcaatcggc
cagccgacgcgagagacggccgaggacgccggcatctcggtcgatgtcgttcccgaccag
gccgacttcgaggcgctggcctgcgaggctatcgaggcggccgctccgactcaccacgag
taa

DBGET integrated database retrieval system