KEGG   Haloarcula marismortui: rrnAC3228Help
Entry
rrnAC3228         CDS       T00211                                 

Gene name
acs5
Definition
(GenBank) putative acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma00620  Pyruvate metabolism
hma00640  Propanoate metabolism
hma00680  Methane metabolism
hma00720  Carbon fixation pathways in prokaryotes
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC3228 (acs5)
   00620 Pyruvate metabolism
    rrnAC3228 (acs5)
   00640 Propanoate metabolism
    rrnAC3228 (acs5)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    rrnAC3228 (acs5)
   00680 Methane metabolism
    rrnAC3228 (acs5)
Enzymes [BR:hma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     rrnAC3228 (acs5)
Lipid biosynthesis proteins [BR:hma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   rrnAC3228 (acs5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAV47930
UniProt: Q5UXS3
Position
I:complement(2851651..2853645)
Genome map
AA seq 664 aa AA seqDB search
MSDEDVQLEARLEEQEVFEPPESFVEQANVTDEGIYDEFEENWPECWEGAADLLDWEEEY
DQVLDDSNPPFYEWFTDGTLNASANCLDRHLDERGDEAAIEWVGEPVEEDNITYTYEELH
QKVNEFAAGLREMGVGEDDVVTMYMPMIPQLPIAMLACARIGAPHSVVFAGFSADALATR
MNSADSEYLVTCDGYYRRGDPLDHLDKANEGLSGVDHEVERAIVAERLMDGDGFDHDYAD
NQVAFEDVIDDNEGETVEPVDRDAEDMLFLMYTSGTTGKPKGVKHSTGGYLAWAAWTSQA
VLDIKPEDTYFCSADIGWITGHSYIVYGPLALGTTTMMYEGTPDYPDKDRLWDIVEEYEA
DQLYTAPTAIRAFMKWGKQYPEQHDLSSLRLLGTVGEPINPRAWKWYYKHIGNEECPVVD
TWWQTETGGMMITTLPGVKDMKPGSAGPPLPGNDVRIVDTEGEEVEPGRAGYLTVDKPWP
GMLRTLYKNDERFIDEYWAEYSDTDSDDSDDWVYFPEDGAKIDDDGYITVLGRVDDVINV
SGHRLGTMEIESAIVGVEGVAEAAVVGGDHDIKGEAVYAYVITEDGYDEDEELRSAIIDG
VEDAIGPIARPEAVIFTPELPKTRSGKIMRRLLEDIANGEELGDTSTLRNPDVVSDIETK
VQGD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgaagatgtccaactcgaagcacggctcgaagagcaggaggttttcgagccg
ccggagtcgttcgtcgagcaggcgaacgtcacggatgagggtatctacgacgagttcgag
gagaactggccggagtgctgggagggggccgctgaccttctcgactgggaggaggagtac
gatcaggtactcgacgactcgaacccgccgttctacgagtggttcacagacgggacgcta
aacgcctcagcgaactgtctggaccgccacctcgacgagcgcggcgacgaagccgctatc
gagtgggtcggcgagccagtcgaggaagacaatatcacctacacgtacgaggaactccat
cagaaggtcaacgagttcgcggccggcctgcgtgagatgggtgtcggcgaagatgatgtc
gtgacgatgtatatgccgatgattccgcagcttcccatcgccatgctggcctgtgcccgc
atcggcgcgccccactccgttgtgttcgccggcttctccgcggacgcgctcgcgacccga
atgaactccgccgactcggagtatctggttacctgcgacggctactaccgccgcggcgac
ccgcttgaccacctcgacaaagccaacgaagggctgagcggcgttgaccacgaggtggaa
cgcgccatcgtcgccgaacggctgatggacggcgacggcttcgaccacgactacgcggac
aatcaggtcgccttcgaggatgtcatcgacgacaacgaaggcgagactgtcgaaccagtc
gaccgcgacgccgaggacatgctgttcctcatgtacacctccgggaccaccgggaaacca
aaaggcgtcaaacactccaccggcggctacctcgcctgggcggcctggacatcgcaggcg
gtgctcgacatcaaacccgaggacacgtacttctgctctgccgatatcggctggattacc
ggtcactcctacatcgtctacggcccgctcgcgctcgggacgacgacgatgatgtacgag
gggacgccggactaccccgacaaggaccgcctctgggacatcgtcgaggagtacgaagcc
gaccaactgtacaccgcgccgacagctatccgggcgttcatgaagtggggcaaacagtac
cccgagcaacacgacctctctagcctgcgcctgcttggcacggtcggtgagccaatcaac
ccccgtgcctggaaatggtactacaaacatatcggcaacgaggagtgtcccgtcgtcgac
acctggtggcagaccgaaaccggcggcatgatgataacgacgttacccggcgtcaaggac
atgaaaccggggtcggccgggccgccgctaccgggcaacgacgtacgcatcgtcgacacc
gagggtgaggaagtcgaacccggccgcgccggctacctgaccgtcgacaagccgtggccc
gggatgctccggacgctgtacaagaacgacgaacggttcatcgacgaatactgggccgag
tactcggataccgatagcgacgactctgacgactgggtgtacttccccgaggacggcgca
aaaatcgacgacgacggctacatcaccgtgctgggacgggtcgacgacgtgatcaacgtc
tccggccaccgtctcgggacgatggaaatcgagagcgctatcgtcggcgtggaaggcgtt
gccgaagccgctgtcgtcggtggcgaccacgatatcaagggcgaggcggtgtacgcctac
gtcatcaccgaggacggctacgacgaggacgaggaactccgcagtgcgattatcgacggc
gtcgaggatgctatcggcccgatcgcgcggccggaagcggtcatcttcacgcccgaactg
ccgaagacccgctccgggaagatcatgcgccgcctgctggaagacatcgccaacggcgag
gaactgggcgatacgagtacgctgcgaaaccctgacgttgtcagtgatatcgagaccaag
gtccagggtgactga

DBGET integrated database retrieval system