KEGG   Haloarcula marismortui: rrnAC3228Help
Entry
rrnAC3228         CDS       T00211                                 

Gene name
acs5
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rrnAC3228 (acs5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC3228 (acs5)
   00620 Pyruvate metabolism
    rrnAC3228 (acs5)
   00640 Propanoate metabolism
    rrnAC3228 (acs5)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    rrnAC3228 (acs5)
   00680 Methane metabolism
    rrnAC3228 (acs5)
Enzymes [BR:hma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     rrnAC3228 (acs5)
Lipid biosynthesis proteins [BR:hma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   rrnAC3228 (acs5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2851651..2853645)
Genome map
AA seq 664 aa AA seqDB search
MSDEDVQLEARLEEQEVFEPPESFVEQANVTDEGIYDEFEENWPECWEGAADLLDWEEEY
DQVLDDSNPPFYEWFTDGTLNASANCLDRHLDERGDEAAIEWVGEPVEEDNITYTYEELH
QKVNEFAAGLREMGVGEDDVVTMYMPMIPQLPIAMLACARIGAPHSVVFAGFSADALATR
MNSADSEYLVTCDGYYRRGDPLDHLDKANEGLSGVDHEVERAIVAERLMDGDGFDHDYAD
NQVAFEDVIDDNEGETVEPVDRDAEDMLFLMYTSGTTGKPKGVKHSTGGYLAWAAWTSQA
VLDIKPEDTYFCSADIGWITGHSYIVYGPLALGTTTMMYEGTPDYPDKDRLWDIVEEYEA
DQLYTAPTAIRAFMKWGKQYPEQHDLSSLRLLGTVGEPINPRAWKWYYKHIGNEECPVVD
TWWQTETGGMMITTLPGVKDMKPGSAGPPLPGNDVRIVDTEGEEVEPGRAGYLTVDKPWP
GMLRTLYKNDERFIDEYWAEYSDTDSDDSDDWVYFPEDGAKIDDDGYITVLGRVDDVINV
SGHRLGTMEIESAIVGVEGVAEAAVVGGDHDIKGEAVYAYVITEDGYDEDEELRSAIIDG
VEDAIGPIARPEAVIFTPELPKTRSGKIMRRLLEDIANGEELGDTSTLRNPDVVSDIETK
VQGD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgaagatgtccaactcgaagcacggctcgaagagcaggaggttttcgagccg
ccggagtcgttcgtcgagcaggcgaacgtcacggatgagggtatctacgacgagttcgag
gagaactggccggagtgctgggagggggccgctgaccttctcgactgggaggaggagtac
gatcaggtactcgacgactcgaacccgccgttctacgagtggttcacagacgggacgcta
aacgcctcagcgaactgtctggaccgccacctcgacgagcgcggcgacgaagccgctatc
gagtgggtcggcgagccagtcgaggaagacaatatcacctacacgtacgaggaactccat
cagaaggtcaacgagttcgcggccggcctgcgtgagatgggtgtcggcgaagatgatgtc
gtgacgatgtatatgccgatgattccgcagcttcccatcgccatgctggcctgtgcccgc
atcggcgcgccccactccgttgtgttcgccggcttctccgcggacgcgctcgcgacccga
atgaactccgccgactcggagtatctggttacctgcgacggctactaccgccgcggcgac
ccgcttgaccacctcgacaaagccaacgaagggctgagcggcgttgaccacgaggtggaa
cgcgccatcgtcgccgaacggctgatggacggcgacggcttcgaccacgactacgcggac
aatcaggtcgccttcgaggatgtcatcgacgacaacgaaggcgagactgtcgaaccagtc
gaccgcgacgccgaggacatgctgttcctcatgtacacctccgggaccaccgggaaacca
aaaggcgtcaaacactccaccggcggctacctcgcctgggcggcctggacatcgcaggcg
gtgctcgacatcaaacccgaggacacgtacttctgctctgccgatatcggctggattacc
ggtcactcctacatcgtctacggcccgctcgcgctcgggacgacgacgatgatgtacgag
gggacgccggactaccccgacaaggaccgcctctgggacatcgtcgaggagtacgaagcc
gaccaactgtacaccgcgccgacagctatccgggcgttcatgaagtggggcaaacagtac
cccgagcaacacgacctctctagcctgcgcctgcttggcacggtcggtgagccaatcaac
ccccgtgcctggaaatggtactacaaacatatcggcaacgaggagtgtcccgtcgtcgac
acctggtggcagaccgaaaccggcggcatgatgataacgacgttacccggcgtcaaggac
atgaaaccggggtcggccgggccgccgctaccgggcaacgacgtacgcatcgtcgacacc
gagggtgaggaagtcgaacccggccgcgccggctacctgaccgtcgacaagccgtggccc
gggatgctccggacgctgtacaagaacgacgaacggttcatcgacgaatactgggccgag
tactcggataccgatagcgacgactctgacgactgggtgtacttccccgaggacggcgca
aaaatcgacgacgacggctacatcaccgtgctgggacgggtcgacgacgtgatcaacgtc
tccggccaccgtctcgggacgatggaaatcgagagcgctatcgtcggcgtggaaggcgtt
gccgaagccgctgtcgtcggtggcgaccacgatatcaagggcgaggcggtgtacgcctac
gtcatcaccgaggacggctacgacgaggacgaggaactccgcagtgcgattatcgacggc
gtcgaggatgctatcggcccgatcgcgcggccggaagcggtcatcttcacgcccgaactg
ccgaagacccgctccgggaagatcatgcgccgcctgctggaagacatcgccaacggcgag
gaactgggcgatacgagtacgctgcgaaaccctgacgttgtcagtgatatcgagaccaag
gtccagggtgactga

DBGET integrated database retrieval system