KEGG   Haloarcula marismortui: rrnAC3230Help
Entry
rrnAC3230         CDS       T00211                                 

Gene name
acs3
Definition
(RefSeq) acyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rrnAC3230 (acs3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC3230 (acs3)
   00620 Pyruvate metabolism
    rrnAC3230 (acs3)
   00640 Propanoate metabolism
    rrnAC3230 (acs3)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    rrnAC3230 (acs3)
   00680 Methane metabolism
    rrnAC3230 (acs3)
Enzymes [BR:hma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     rrnAC3230 (acs3)
Lipid biosynthesis proteins [BR:hma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   rrnAC3230 (acs3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2855548..2857506)
Genome map
AA seq 652 aa AA seqDB search
MYCQLMTRGDEPDRGQSQTGRETVEPPDWFVKQANVTDLAVYDRFEREWPDCWREAAELL
DWEKPFETVLRGTDGPPFEWFPDGRLNAAYNCLDRHLPERKNQLALVWEGHLGESRTYTY
LELYREVNAFAAALRDRGVGPDDVVTLYLPMVPELPVAMLACARLGVPHNVVFAGFSADA
LATRMERAESEYLITCDGYYRRGSAVAQKNKADNARITVDHDVSVVVLDRLGRDVHLGDD
YVDYHDLLAAHEGAEVEPVSQAADDPLFRIYTSGTTGQPKAVTHTTGGYLAHVAWTARSV
LDIKPEDTYWCSADIGWITGHSYIVYGPLALGTTTVLYNGTADHPEKDRLWELIEKYAVD
VFYTAPTAVRAFMKWGEQYPEQHDLSSLRLLGTVGEPMDAHAWEWYREHIGGGECPVVDT
WWQTETGAILVSTLPGVDEMKPGAAGTPLPGIEASVVTRSGATAEPNTAGELVVTRPWPG
MPRALLDGTGWGSAPDSAEEWRYYPEDSVSVDADGYITFLGRIDDAINVAGRRFSTKELE
STVAGVTGVAEAAVVGADDETTGTAVYVFASPEDGYAESELQTAIEDAIVNAIGGIARPK
EVVFTPDLPKTRSGKVMRRLLTSVANDEDLGDTSALRNPEILGEIQSTTRRK
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtactgtcaactgatgacacggggtgacgaaccggatcggggccagtcccagacgggg
cgagagacagtcgaaccaccggactggttcgtcaaacaggcgaacgtgacggacttggct
gtctacgaccgcttcgaacgggagtggcccgattgctggcgcgaggccgccgagttgctt
gactgggagaagccgtttgagacggtactccgtggaacggacggaccaccgttcgaatgg
ttccccgacggccgattaaacgccgcatacaactgtcttgaccggcacctccccgagcgc
aagaaccaactagcactggtctgggagggacacctcggcgagtcccgcacctacacgtac
ctcgaactgtaccgggaggtcaacgcctttgcagcagcgttgcgcgaccgcggcgtcggc
ccggacgacgtggtgacgctgtacctcccgatggtgcccgagctcccggtcgcgatgctg
gcctgtgcccgtcttggcgtgccacacaacgtcgtcttcgccgggttctctgcggacgcg
ctcgcgacgcgaatggagcgagccgagtcagagtatctcattacctgtgacggctactac
cgccgcggtagcgccgtcgcacaaaagaacaaggccgataacgcgcgaatcactgtcgac
cacgacgtgtcggtcgtcgtgcttgaccgactgggccgtgatgtgcatttaggcgacgac
tacgtcgactatcacgacctgctggcggcccacgaaggagccgaagtcgagcccgtttcg
caggcagcggacgacccgctttttcgcatctacacctcgggcacgaccgggcagccgaag
gctgtcacccacacgaccggggggtatctcgcacacgtcgcctggaccgcccggtcagtt
ctcgacatcaagcccgaagacacctactggtgttcggccgacatcggctggattaccggc
cactcctacatcgtctacggcccgctcgcgcttggaacgacgacagtactgtacaacggc
acagcggaccaccccgagaaagaccgcctgtgggagctcatcgagaagtacgccgttgac
gtgttctatactgcgccgacggcagtccgggcgttcatgaagtggggtgaacagtacccc
gagcaacacgacctctccagcctgcgcctgctgggcacggttggcgagccgatggacgct
cacgcctgggagtggtatcgcgaacacatcggcggcggcgagtgcccagtcgtggacacc
tggtggcagaccgaaaccggtgcgatactcgtatcgacgctgcccggtgtcgacgaaatg
aaacccggggccgctggaaccccactgccgggaatcgaggcatccgtcgttacccgctcg
ggcgcaacagccgagccgaacacggccggggaactcgttgtgacgcgcccctggccgggg
atgccccgcgcgttacttgacgggacgggctggggcagcgccccggacagcgccgaggaa
tggcggtactaccccgaagacagcgtctcggtcgacgctgacggttacatcacgttcctc
ggtcggatcgacgacgcgatcaacgtcgccggccggcggtttagcaccaaggaactggag
tcgacggtcgccggcgtcaccggcgtcgccgaagccgccgtcgtcggtgccgacgacgag
acgaccggaacggcggtgtacgtgtttgcttctccggaggacggctacgccgagagtgaa
ctccagacagccatcgaggacgctatcgtcaacgccatcggtggtatcgcccgcccgaaa
gaggtcgtgttcacgcccgacctcccgaaaacgcgctcgggcaaggttatgcgccgcctg
ctgacgtcagtggcgaacgacgaggatctgggcgataccagcgcgctgcgaaaccccgaa
attctcggcgaaatccagtcgactacgagacggaagtaa

DBGET integrated database retrieval system