KEGG   Haloarcula marismortui: rrnAC3505Help
Entry
rrnAC3505         CDS       T00211                                 

Gene name
thrC1
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    rrnAC3505 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    rrnAC3505 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    rrnAC3505 (thrC1)
Enzymes [BR:hma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     rrnAC3505 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3092637..3093809
Genome map
AA seq 390 aa AA seqDB search
METTAAFRGLICTACGAETDSTADRCPDCGGVLVGDYDVPDLTPEALPDVTGPGRYEPLR
PFSGDATVTLDEGATPLVPVPELADELGVDSVYVKDEGRNPTASLGDRKLSLAVTAAAQR
GAERVATPSTGNGAQANAAYAARAGIESKGFVPSRCPFLNKAMVNVHGGDMRVVEGRYDD
AASVSDEELADASDGWVSVAPGHPFRIEGAKSVAFETADDLDWTAPDAVVHPTGHGETLV
GLEHGFQAAAESGLTDSTPRIYAAQPDSTAAIADAASEGASEPATIEHPDTIVGPLEVPD
PAAGAAALDSLDRSGGDGVAVSDKDILAGAVDGCEMGPETGATGGTAIAGARALADDGAF
DDDDVVVLVNPVAGSKEADLLRSHLMSQGI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggagacgactgcggcgtttcgcggcctcatctgcacggcgtgtggcgcggaaaccgac
agcacggccgaccgctgtcccgactgtggcggggttctcgtcggtgactacgatgttccg
gacctgacgcccgaggcgctgcccgatgtgacagggccaggccggtacgagccgcttcgg
ccgttctcgggtgacgcaacggtgacgctcgacgaaggggcgacaccgctggttccggtg
ccggagctggccgacgaactcggcgtcgactcggtgtacgtcaaagacgaggggcgtaat
ccgacggcgtcgctgggcgaccgcaaactttcgctcgccgtcaccgctgccgctcagcgc
ggagctgagcgcgtcgcgacaccgtcgacggggaacggcgcacaggccaacgccgcctac
gcggcccgcgccggcatcgagtcgaagggctttgtcccctcacgctgcccgttcctcaac
aaggcgatggtgaacgtccacggcggcgacatgcgcgtcgttgagggccggtatgacgac
gccgcctcggtgtcggacgaggaacttgccgacgcgtccgacggctgggtctcagtcgcg
cccggccacccgttccgcatcgagggtgccaaatccgtcgcgttcgagacggctgacgac
ctcgactggacggcccccgacgcggtggtccaccccaccggccacggcgagacgctcgtc
ggtctcgaacacggctttcaggcggcagccgagagcggcctcacggactcgacgccgcga
atctacgccgcacagcccgactcgacggccgccatcgcggatgccgcaagcgagggtgcg
agcgaaccggcgactatcgagcaccccgacaccatcgtcggcccgcttgaggtccccgac
cctgccgccggcgctgcggcgctcgactcgcttgaccgctcgggcggcgacggcgtcgcc
gtctcagataaggacattctggctggcgcggtcgacggctgcgagatggggccggaaacc
ggtgcgaccggcgggaccgcgatcgccggtgcgcgggcactggctgacgatggggccttc
gacgacgacgatgtcgtcgttctagtgaaccctgtcgccgggagcaaggaggcggacctg
ctgcgcagccacctcatgagccagggcatctga

DBGET integrated database retrieval system