KEGG   Haloarcula marismortui: rrnAC3506Help
Entry
rrnAC3506         CDS       T00211                                 

Gene name
adh2
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
K00344  NADPH2:quinone reductase [EC:1.6.5.5]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma00071  Fatty acid degradation
hma00350  Tyrosine metabolism
hma00625  Chloroalkane and chloroalkene degradation
hma00626  Naphthalene degradation
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC3506 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    rrnAC3506 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    rrnAC3506 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    rrnAC3506 (adh2)
   00626 Naphthalene degradation
    rrnAC3506 (adh2)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     rrnAC3506 (adh2)
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     rrnAC3506 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AAV48175
UniProt: Q5UX28
Position
I:3093916..3094929
Genome map
AA seq 337 aa AA seqDB search
MRVAAFSELTGPDGVSVIDQATPEPEHGEAVVSVEACAINRHDLWVLEGDPAMVDTDDLP
FVSGLDVAGTVDAVGDGVTAVEPGDRVVLCPNETCGTCRYCREGPENLCENFSLYHGGLT
EAARVQADRLVRLPDGVEPVDAAALPTAYMTAFHMLRRVDAGPGDLVFIPGVTGGVGVAG
VQLASVLGAHSVGTSSSAAKLTRVESLGLDYAIESTDPDEIRAAVTEIGTVDGVLNHLGG
EYTQVGLDVLRRGGRMAVCGRTAGGTSEINIPDLFLGHKRVIGSTMGTQGDLERLVDLVA
DGELTPEIEATYSLEETGAAFAAMQDRDSVGKLVVTP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttgcagcgttcagcgaactcaccggcccggacggcgtctcggttatcgaccaa
gcaaccccagagcccgaacacggcgaggcagtggtctccgtcgaagcgtgtgcgatcaac
cgccacgacctctgggttctcgagggggatcccgcgatggtcgacacggatgatttaccg
tttgtcagcggtctcgatgtcgccgggaccgtcgatgccgtcggcgacggggttaccgct
gtcgaacccggggaccgcgtggtcctctgtccgaacgagacctgcgggacgtgtcgctac
tgtcgtgaggggccggagaacctctgtgagaacttctcgctgtaccacggtggcctcacc
gaggcggcccgtgtgcaggccgaccgcctcgtcaggcttcccgacggcgtggaaccggtc
gacgcggccgcgcttccgacggcctacatgacggccttccatatgctccgtcgggtcgac
gctggaccgggcgatctggtgtttatcccgggcgtcaccggcggtgtcggcgtcgcaggc
gtgcaactcgcgtccgttctcggcgctcacagcgtcgggacctcgtcttcagcggcgaag
ctaactcgcgtcgaatcgctcggtctggactacgccatcgagagcaccgatccggacgag
attcgggcagcggtcaccgagatcgggacggttgatggcgtcctcaatcacctcggtggt
gagtacacgcaggtcggtctggatgttctccgtcgcggtggccggatggccgtctgtggt
cggaccgccggcggcacatccgagatcaatattcccgacctgttcctcggtcacaagcgc
gttatcgggagtacgatggggacgcagggcgatttggaacgacttgtcgacctcgtcgct
gacggcgaactcaccccggagatagaggcgacgtactccctggaggagaccggtgcggcg
tttgcggcgatgcaggaccgcgatagcgttggaaagctcgtcgtgacgccgtag

DBGET integrated database retrieval system