KEGG   Haloarcula marismortui: rrnB0198Help
Entry
rrnB0198          CDS       T00211                                 

Gene name
pdhC1
Definition
(GenBank) dihydrolipoamide S-acetyltransferase component of pyruvate dehydrogenase complex E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma00020  Citrate cycle (TCA cycle)
hma00620  Pyruvate metabolism
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01200  Carbon metabolism
Module
hma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnB0198 (pdhC1)
   00020 Citrate cycle (TCA cycle)
    rrnB0198 (pdhC1)
   00620 Pyruvate metabolism
    rrnB0198 (pdhC1)
Enzymes [BR:hma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     rrnB0198 (pdhC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AAV48382
UniProt: Q5UWH1
Position
II:complement(160459..162081)
Genome map
AA seq 540 aa AA seqDB search
MPPCRSIHWRITTCHRRSVSKTASAKQSISNMVREFELPDVGEGVAEGELLRWRVEPGDA
VSEDQPVAEVETDKAVVDVPSPVDGVVEELRAAEGEMVPVGDVIIVFRVDGEDGPKATET
APADDTTAGSGQQTEVGATAQPAEETQSEPAITQRVQVPAPPSVRRLARELGVDISSVAD
SSSGRITEPDVRAYASPESSTQERSSQQTTAAEQRTQQAAPAQSVSPAQTREVVDRETTV
AVPKTRHIAAEEGIDLDTVPTDEQKDGEPFVTLEAVQEYAEAQQQAQQTDRDAVVERAAA
DEPARPESRKPYKGIRQTIGAAMTSSKYTAPHVTHQDEVDVTALVDARSTLRREAEAQDI
RLTYMPFVMKACAAALQENPQVNVSLDEANEEIVEKQYYNIGVATATDDGLLVPVVENVD
AKGLLEVASETNEKTQKARERSLSPEEMRGGTFTISNIGGIGGEYGTPIINQPESAILAL
GEIKKKPRVVEADGEETIEPRHIMTLSLSFDHRVLDGADAAQFTNSIQKYLQNPNLLLLE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcccccatgccgctccattcactggaggattactacctgccacaggcggtccgtatcc
aagacggcatccgcgaaacagtcgatttctaacatggtacgcgaattcgaactccccgat
gtcggagaaggcgtcgccgagggcgaactgcttcgctggcgtgttgagccgggtgacgca
gtttccgaggaccagccagtcgcggaagtcgagaccgacaaagccgtcgttgacgtccca
tcccctgttgacggtgttgtcgaagaactccgtgctgcagaaggtgagatggtcccagtc
ggtgatgtgattatcgttttccgggtcgacggtgaagacggtccgaaagcaactgaaaca
gcgcctgcagacgacaccactgcgggcagtggccagcaaaccgaagttggagccacagca
cagccagccgaagagacgcagtcagaaccagcgattacacagcgcgtccaggtccccgcc
ccgccgtctgtgcggcgtctcgcccgcgaactgggcgtcgatatttccagcgttgcggac
tcgtcttcgggacgtataacggagccggatgtccgcgcgtacgcgagtccggaatcctcg
actcaggagcgttcaagccaacagaccactgctgccgagcaacgaacacagcaggcagcc
ccggcgcagtctgtcagtccggcacagacgagagaagtggtagaccgggagacgacggtg
gccgtcccgaaaacgagacacatcgcagcggaggaaggaattgatctcgatactgtcccc
actgatgaacaaaaagacggagaaccgtttgtcacgctcgaagcggtccaagagtatgcc
gaggcacagcagcaggcacagcagacggatcgagacgcggtagttgagagggcagcggca
gacgagccagcgcgccccgagtctcggaagccgtacaaggggatcaggcagacgattgga
gcggcgatgacatcgtcgaaatatacggccccacacgtcactcatcaggatgaggttgat
gttactgcgctggtcgatgctcgttcgaccctcagacgggaggccgaggcgcaagatatc
cgactgacgtatatgccgttcgtaatgaaagcgtgtgccgcggctctacaagagaatccg
caggtaaatgtctctctcgacgaagcaaacgaagagatagtcgaaaagcagtattacaac
atcggtgtcgcaacggcaactgatgacgggctgctggttcccgttgtcgagaatgttgat
gcgaaaggcctgctggaggtcgcatcggaaaccaacgaaaaaacccagaaagcgagagaa
cgcagtctctcgccggaggaaatgcgcggcgggacatttactatctcgaacatcggcggg
attggcggggagtatggaacgccaatcatcaaccagccggagagcgctatcctggcactg
ggtgaaattaaaaagaagccacgggtcgtcgaagcggatggtgaagagacgatagaacct
cgtcacatcatgacactctcgctgtcgttcgatcatcgagtgcttgatggcgcagacgcc
gcacaatttacaaactccatacagaagtacctgcaaaatccaaacctgctactactagaa
taa

DBGET integrated database retrieval system