KEGG   Haloarcula marismortui: rrnB0265Help
Entry
rrnB0265          CDS       T00211                                 

Gene name
acs4
Definition
acyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rrnB0265 (acs4)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnB0265 (acs4)
   00620 Pyruvate metabolism
    rrnB0265 (acs4)
   00640 Propanoate metabolism
    rrnB0265 (acs4)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    rrnB0265 (acs4)
   00680 Methane metabolism
    rrnB0265 (acs4)
Enzymes [BR:hma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     rrnB0265 (acs4)
Lipid biosynthesis proteins [BR:hma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   rrnB0265 (acs4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(219956..221806)
Genome map
AA seq 616 aa AA seqDB search
MSPECVYLHGCRKRICLRYTQYKYYLRRKPNSNWYNIFCVESNRYSYTGNRYSERCMVTS
HNLPDYDTARQEFSWDDIYADADWDAPNDLNIGHEVADRHATDRGQVALYQVGTDGELSK
MTFWELADRSSQFANVLDDLGVAQGDRVFSYMPRIPEHYVALVGTLKHGAVWGSVNERFG
PDGISYRLDDCDAKVVVTTTNNRDTVEDALDDAPAVEHVITVDRGGGAPADDVVFNTALD
GASTAYEVAETSGEDDALLYYTSGTTGLAKGVLHKQRWIAGVAATQKHAVDLQDGDLYWS
TGDLGWLTGAINTLGAWFWGASLFTYEGEFDTDEWAALLDEYPISVLFSVPTAYRMLREN
EDVLADVNLDLRHALSIGEPLSAGVVEWGEDELGVTILDTYGQTETGNMIINNYPTMELR
PGSMGKPLPGIEADIVDPQSGEVLEPGETGEIAQRGDYPCFFAEFWNKPKKTQRAFIDGP
DGKWYLSGDLAHKDEDGYFWFEGRADDVILSSGYRIGPFEVESSLGEHEAVAEAAVVPKP
HEARGNIVKAYVVPSDDAEPSDPLKEDIQSYVKEELSAHEYPREIEFREELPKTVTGKIR
RTELHDDAEAEAEVES
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgagtgtgtatatcttcacggatgtcgtaaacgcatctgtttacgctataca
cagtacaaatactacctacgaaggaagccaaatagtaattggtacaatatattttgcgtg
gaaagtaaccggtacagttataccggaaaccggtattccgagcggtgtatggtgaccagc
cacaacctcccggactacgacacagcacggcaagaattctcctgggacgatatttacgcg
gacgcggactgggatgcaccgaacgacctgaacatcggacacgaagttgccgaccgacac
gcgaccgaccggggacaggtcgcactctatcaggtcgggaccgacggagagctgtcgaaa
atgacgttctgggagcttgctgaccgctcaagccagtttgccaacgtccttgacgacctc
ggggttgcgcagggcgaccgggttttctcgtatatgcctcgaatccccgagcactacgtg
gcgctggtcggaacgctcaaacacggtgcggtctggggaagcgtcaacgagcggttcggg
cccgatggcatctcgtaccgtctggacgactgcgacgcgaaggtcgtcgtcactacgact
aacaatcgcgacacggtcgaagacgcactggacgatgcgccggcggtcgaacacgtaatc
actgttgaccgcgggggcggcgcacccgctgacgacgtggtcttcaatactgcgctcgac
ggcgcgagcacagcctacgaggttgccgagaccagcggggaagacgacgcactgctgtac
tacacctcaggaaccactgggctggccaaaggcgtcctccacaagcagcgctggatcgcc
ggtgtcgcggcaacacaaaaacacgccgtggatcttcaggatggcgacctgtactggtca
actggcgacctcggctggctgacgggtgcaatcaacacactcggtgcctggttctggggt
gcgtcgctgttcacgtatgagggcgagttcgacaccgacgagtgggccgccctgctggat
gaatacccgatcagcgtcctgttctcggtcccgacggcctaccggatgctccgggaaaac
gaagacgtgcttgccgatgtcaaccttgatttacggcatgcgctctctatcggcgaacca
ctcagtgccggggtcgtcgagtggggagaggacgaactcggtgtcacgattctcgatacg
tacgggcagaccgagaccgggaacatgattatcaacaactatccgacgatggaactccgg
cccgggtcgatggggaaaccactccctggaatcgaggccgacatcgtcgacccacagagc
ggtgaagttctggaacccggcgaaacgggcgagattgcgcaacgaggagactatccgtgt
ttcttcgccgagttctggaacaagcccaagaaaacccagcgggcgttcatcgacggtccc
gacgggaaatggtatctctcgggcgatctggcacacaaggacgaggacgggtatttctgg
ttcgaagggcgggcagacgacgtgatcctctcttcgggctaccgcatcgggccgttcgag
gtcgagagttcgctgggcgaacacgaagcggtcgctgaggcggccgtcgttcccaaacct
cacgaagcgcggggcaacatcgtcaaggcctatgttgtgccgagcgatgacgcggagccg
tccgacccactcaaagaagacatccagagctacgtgaaagaagagctctccgcacacgag
tacccgcgcgaaatcgagttccgcgaggaactgcccaagaccgtgactggaaagatccgc
cgaaccgagctccacgacgacgccgaagcagaagctgaagtcgaatcctga

DBGET integrated database retrieval system