KEGG   Hyphomicrobium sp. MC1: HYPMC_0040Help
Entry
HYPMC_0040        CDS       T01557                                 

Gene name
dapE
Definition
N-succinyl-diaminopimelate deacylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hmc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hmc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(33512..34684)
Genome map
AA seq 390 aa AA seqDB search
MTLVPTDPVALAQALIRCESVTPDEAGALTLLQNVLEPAGFTCHRLVFSEPGTPDVDNLY
ARLGTGRPHLSFAGHTDVVPVGNEAAWTVPPFAGEVRDGILYGRGAVDMKGCVAAFLAAA
MKYIHHYNGLPRGSLSFIITGDEEGPSINGTMKILDWLKARDEVVDACLVGEPSNPKALG
DEIRIGRRGSLTIDLIVHGKQGHSAYPQLADNPVPKLARIIDRLSTTKLDDGTENFQPSD
LQVTVVSVPNTATNVIPGRAVARANIRYNDAWTRPKIEDWVSKTVAAAAKEVDAKYDLEF
SGTGDVFLTKPGPLVSTLKDAVKSVTGRTPALTTGGGTSDARFIRDICPVVEFGLVNATI
HQVDEHTSISDLETLTTIYERFITNYFRNG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgttccgacagatcccgtagcgctcgcgcaggctctcattcgctgcgaaagc
gtcacgcccgacgaagccggcgctctgacgctgctgcaaaacgtgctcgaaccggccggt
ttcacgtgccatcgtctcgtgttctcggaacccggcacgcccgacgtcgataacctctat
gcgcgcctgggtaccggcagaccgcatctttcgtttgctggccataccgacgtcgttccc
gtcggcaacgaagcggcctggacggtccccccatttgccggagaagtgcgcgacggtatt
ctctacggtcgcggcgctgtcgatatgaaaggctgcgtcgccgcgttcctcgccgccgcc
atgaagtacattcatcactacaatggcctgccgcgcggctcattgtcgttcatcatcacg
ggcgacgaagaaggcccgtcgatcaacggcacgatgaaaattctcgactggctgaaagcg
cgtgacgaagtcgtcgatgcctgtctcgtcggcgaaccgtcgaacccgaaagctttaggt
gatgaaatccgcatcgggcggcggggctcgctgacaatcgatcttatcgtgcacggcaag
cagggccactcggcctatccgcagctcgcggacaatccggtgccgaagctcgcgcgcatc
atcgaccggctgtcgaccacgaaactcgacgacggcaccgaaaacttccaaccgtcggac
ttgcaggtgacggtcgtctccgtgccgaacacagcgacgaacgtcatccccggccgcgca
gtggcgcgcgcgaatattcgctataacgacgcctggacgcgccccaagatcgaagactgg
gtcagcaagacggtcgccgccgccgcaaaagaagtcgacgccaaatacgatcttgaattt
tccggtaccggcgacgtcttcctgacgaagcccggcccgcttgtttccacactgaaagac
gcggtcaaatccgtcaccggccggacgcccgcgctgacgaccggcggcggcacgtcggat
gcgcgtttcatcagagatatttgccctgtggtcgagttcggcctcgtcaacgccacgatc
catcaggtcgacgagcacacgagcatctccgatctcgaaaccctgacgacgatctacgaa
cgcttcatcacgaattatttccgcaacggctga

DBGET integrated database retrieval system