KEGG   Hyphomicrobium sp. MC1: HYPMC_0098Help
Entry
HYPMC_0098        CDS       T01557                                 

Gene name
ccr
Definition
crotonyl-CoA carboxylase/reductase
Orthology
K14446  
crotonyl-CoA carboxylase/reductase [EC:1.3.1.85]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glyoxylate and dicarboxylate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HYPMC_0098 (ccr)
Enzymes [BR:hmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.85  crotonyl-CoA carboxylase/reductase
     HYPMC_0098 (ccr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98220..99533
Genome map
AA seq 437 aa AA seqDB search
MSSQNLAAKSEVSDASVTAGIKKDLYEIGEIPPLGHVPKNMYAWTIRKERQGEPDKAMQV
EVVPTWELDSHDVLVLVMAAGVNYNGVWASLGVPISMFDVHKQPYHIAGSDASGIVWAVG
SKVKRWKVGDEVVVHCNQDDGDDEECNGGDPMFSTSQRIWGYETPDGSFAQFCRVQDRQL
LERPKHLTWEESACYTLTLATAYRMLFGHRPHVLRPGHNVLVWGAAGGLGAFAVQLCATS
GANAIGVVSDDDKRDFVMQLGAKGVINRKDFKCWGQLPKVNSPEYHEWLKEMRKFGKAIW
DITGKGVNVDCVFEHPGETTIPVSVQVVKRGGMVVICAGTTGYNLTMDARYLWMHQKRVQ
GSHFANLMQASQANRLVIERRIDPCMSEVFSWEQIPKAHMRMMRNEHKPGNMAVLVQAPT
TGLRTLEDVIEAGPKSA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccagaacttggcagccaaaagcgaagtatccgatgcttcggtgacggcagga
atcaagaaagacctttatgaaatcggggaaattcccccgctcggacatgttcccaaaaac
atgtacgcctggactatccgcaaggagcgtcagggtgagcccgacaaggcgatgcaggtt
gaggtggttcccacgtgggaactcgatagccacgacgtgctcgtcctcgttatggcggcc
ggcgtcaactacaacggcgtgtgggcatcgctcggcgtgccgatctcgatgttcgacgtc
cacaaacagccttaccacatcgctggatcggatgcttcgggcatcgtttgggccgttggc
tcgaaggtgaagcgctggaaggtcggcgacgaggttgtggttcactgcaaccaagacgac
ggcgacgatgaagaatgcaacggcggcgatccgatgttttcgacgtcgcagcgcatctgg
ggttacgagacgccagacggttcgtttgcgcaattttgccgcgtgcaggaccgccagctt
ctcgaacgtccgaagcatctgacgtgggaagaaagcgcctgctacacgctgacgctcgca
accgcttaccgcatgctgttcggccatcgtccgcatgtcctgcggcctggccataacgtg
ctggtgtggggtgctgccggtggtcttggcgcattcgccgtgcagctgtgcgcgacgtcg
ggcgccaacgccatcggcgtcgtgtcggatgacgacaagcgcgacttcgtcatgcagctc
ggcgcgaagggcgtcatcaaccgcaaggacttcaagtgctggggacagctgccgaaagtg
aactcgcctgagtatcacgagtggctgaaggagatgcgcaagttcggcaaagcgatctgg
gacatcacgggcaaaggtgtcaacgtcgactgcgtgtttgagcatcccggcgagacgacg
attccggtctcggtgcaggtcgtgaagcgcggcggcatggtcgtgatttgcgccggcacc
accggctataatctgacgatggacgcgcgctatctctggatgcaccagaagcgcgtgcaa
ggttcgcacttcgccaacctgatgcaggcaagccaggccaaccgtctcgtcatcgagcgg
cgtatcgacccgtgtatgtcggaagtgttctcgtgggagcagatccccaaggcgcacatg
cgcatgatgaggaacgagcacaagccgggcaacatggcggtgcttgtccaggcgccgacg
acgggtcttcgcacgcttgaagatgtcatcgaggccggcccgaagtcagcctaa

DBGET integrated database retrieval system