KEGG   Hyphomicrobium sp. MC1: HYPMC_0236Help
Entry
HYPMC_0236        CDS       T01557                                 

Definition
class II aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hmc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(232230..233021)
Genome map
AA seq 263 aa AA seqDB search
MSDTLTLSKSELVSIAHQRMGTELADGDYSTRQKLALTCRILFDGGHDLGLAGQITARAE
EPGTYYTQPFGHGFDEITEDNLLRVNENLETVDGRGMPNPANRFHTWIYREHPRINCIIH
THPFYCSALSMLEIPLAISHMDTCPLYEDCAFLEKWPGIPVGNEEGIIISGALGEKRAIL
LSHHGMLVTGSTVEEACVLALLMERAAKLQLTAMPVSDIKPVPELLAREAHDWISTPKRY
SVAFNYYVRRALKSHADAIRDAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatacacttacactttcaaaaagcgagttggtctcgatagcccaccaaagaatg
ggcaccgaactggccgatggcgattactcgacgaggcaaaagctcgcgcttacctgccgc
attctttttgacggcggccacgatttaggccttgctggccagatcactgcccgagccgag
gagcccggcacttattacacacagcccttcgggcacggcttcgacgagatcaccgaagac
aatcttcttcgggtcaatgagaatctcgagaccgtcgacggtcgagggatgccaaatcca
gccaatcggttccatacctggatttatcgcgagcatccgcgcatcaactgcatcatccac
acgcacccgttctattgctccgcgctttccatgctcgaaattcctttggctatttcgcac
atggatacgtgtccgctctatgaggactgcgcgtttctcgagaagtggccgggtatccct
gtgggtaatgaagaagggatcatcatatcgggagcgttgggggaaaagcgcgccatcttg
ctttctcaccatggaatgctcgttaccggctccacagtcgaggaagcttgtgtgctcgcg
ttgctgatggagcgagcagcaaagcttcagctaactgccatgccagtctcggacatcaag
cctgtccccgagcttttggcccgcgaggcgcatgactggatttcgacgcccaagcgctat
tccgtcgctttcaactattacgtccgccgcgccctcaagagtcacgcggacgccatccga
gacgcagcctaa

DBGET integrated database retrieval system