KEGG   Hyphomicrobium sp. MC1: HYPMC_0462Help
Entry
HYPMC_0462        CDS       T01557                                 

Definition
(GenBank) Cytochrome c2 (modular protein)
  KO
K08738  cytochrome c
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HYPMC_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CCB63696
UniProt: F8J9K8
Position
453192..453563
Genome map
AA seq 123 aa AA seqDB search
MLRIAKLLVAVAVGIFIIVPSARAAPSAAYGEEIYQSCQDCHSLDTNDVGPKHRGVFGRK
AGAVPDYSYSVALKTSGIVWTEDTLDKWLADPQKLVPGAKMFFHLDAAQDRADVIEYLKE
RAK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcattgcaaaattgctcgttgctgtcgcggtcgggatattcatcattgttccg
agcgccagggccgcgccgagtgctgcatacggtgaagagatctaccaaagctgccaggat
tgtcattcgctcgacaccaacgatgtcggccccaagcatcgcggtgtattcgggagaaag
gcgggagcagttcccgactatagttattcggttgcgctcaagacttccggtatagtttgg
accgaagataccctcgacaaatggctcgcggacccgcagaagctcgttcctggagcgaag
atgttttttcacctcgatgccgcccaagatcgagcggacgtcatagaatatttgaaagag
cgagcgaaataa

DBGET integrated database retrieval system