KEGG   Hyphomicrobium sp. MC1: HYPMC_0537Help
Entry
HYPMC_0537        CDS       T01557                                 

Gene name
pdhB
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HYPMC_0537 (pdhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_0537 (pdhB)
   00020 Citrate cycle (TCA cycle)
    HYPMC_0537 (pdhB)
   00620 Pyruvate metabolism
    HYPMC_0537 (pdhB)
Enzymes [BR:hmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HYPMC_0537 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527114..528385
Genome map
AA seq 423 aa AA seqDB search
MPLVDVKVPNIGDFENVPIIEIQVKPGDEVNADDPLITLESDKASMDVPSPVKGKVAEIL
VTIGDKVSEGSAILRLDTAGESKREPDANGKSREADAAPKSKAAENSSPAEPPEESELPP
PADFDAVFASPSVRRIARELDVDLTKVKGTGNKGRITKEDVKAFIARSGTPAGSGAAMSG
IPEIPPQDFAKYGPVETKPMSRLKRLTGPNLHRAWLNVPHVTNSDDADITDLEAYRKELD
ATAKTKGYRVTLVAFLLKASVSALKEYPEVNASLAPGKDALILKRYYNIGVAVDTPDGLV
VPVIKDVDRKGILELSQELTAVSARMRDGKITPADIQGATFSISSLGGIGGTNFTPIVNA
PEVAILGAVRAQMKPVWDGSTFQPRLMLPLCLSYDHRVVDGALAARFLRKICDALADVRQ
LVL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgtcgatgtcaaagttccgaatatcggtgacttcgaaaatgtgccgatcatc
gagattcaggtaaagcccggtgatgaggtcaacgccgacgatccgctgattacgcttgaa
agcgataaggcgtcgatggatgtgccgtcgcctgtgaaaggcaaggtcgcagaaattctc
gtaacgatcggcgataaggtcagcgaggggagtgccattttacggctcgacacggcgggc
gagagcaagagagaaccggacgcaaacggcaaaagccgcgaagcggacgccgctccgaaa
tccaaggcagcggaaaattcttcccccgctgagccccccgaagaaagcgaactgccgccg
cctgccgatttcgatgccgtctttgcgagtccgtctgtccgacgtatcgcgcgcgaactt
gatgtcgatctgacgaaagtgaaaggcacgggcaacaaggggcggatcaccaaggaggat
gtaaaggctttcattgcgcggagcggaacgccagcgggatcgggcgcggcaatgtccggc
attccggaaatcccgccgcaggattttgcgaagtatgggcctgtcgagacgaagccgatg
tcgcgtttgaagcggctgaccggtcccaatctgcatcgcgcgtggctcaacgtcccgcac
gtcaccaactcggacgatgccgatatcaccgatctcgaagcctatcgcaaagaactcgac
gcgacggcaaagacgaagggctatcgagtgacgcttgtcgcgtttctgctgaaggcttcc
gtctcggcattgaaggagtatcccgaggtcaacgcgtcgctcgcgccgggcaaggatgcg
ctgatcctgaagcgctattacaacatcggcgtcgcggtcgacacgccggatggactagtc
gtgcccgtgatcaaggatgtcgaccgcaagggcatcctggaactcagtcaagagttgacg
gcggtatcggcgcggatgcgcgacggcaagattacgccagcggatattcagggcgcgacg
ttctcgatttcgagcctcggcggcatcggcggcacgaacttcacgccgatcgtcaatgca
ccggaagtcgctattctcggcgcagtgcgcgcgcagatgaagccggtttgggatggctcg
acatttcagcctcggctgatgctcccgctgtgcctgtcctacgatcaccgcgtggtcgac
ggcgcgcttgcagcgcgcttcctgcgcaagatctgcgatgcgctggcagatgtgcggcag
ctggtgctatag

DBGET integrated database retrieval system