KEGG   Hyphomicrobium sp. MC1: HYPMC_0537Help
Entry
HYPMC_0537        CDS       T01557                                 

Gene name
pdhB
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:hmc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hmc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hmc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hmc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527114..528385
Genome map
AA seq 423 aa AA seqDB search
MPLVDVKVPNIGDFENVPIIEIQVKPGDEVNADDPLITLESDKASMDVPSPVKGKVAEIL
VTIGDKVSEGSAILRLDTAGESKREPDANGKSREADAAPKSKAAENSSPAEPPEESELPP
PADFDAVFASPSVRRIARELDVDLTKVKGTGNKGRITKEDVKAFIARSGTPAGSGAAMSG
IPEIPPQDFAKYGPVETKPMSRLKRLTGPNLHRAWLNVPHVTNSDDADITDLEAYRKELD
ATAKTKGYRVTLVAFLLKASVSALKEYPEVNASLAPGKDALILKRYYNIGVAVDTPDGLV
VPVIKDVDRKGILELSQELTAVSARMRDGKITPADIQGATFSISSLGGIGGTNFTPIVNA
PEVAILGAVRAQMKPVWDGSTFQPRLMLPLCLSYDHRVVDGALAARFLRKICDALADVRQ
LVL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgtcgatgtcaaagttccgaatatcggtgacttcgaaaatgtgccgatcatc
gagattcaggtaaagcccggtgatgaggtcaacgccgacgatccgctgattacgcttgaa
agcgataaggcgtcgatggatgtgccgtcgcctgtgaaaggcaaggtcgcagaaattctc
gtaacgatcggcgataaggtcagcgaggggagtgccattttacggctcgacacggcgggc
gagagcaagagagaaccggacgcaaacggcaaaagccgcgaagcggacgccgctccgaaa
tccaaggcagcggaaaattcttcccccgctgagccccccgaagaaagcgaactgccgccg
cctgccgatttcgatgccgtctttgcgagtccgtctgtccgacgtatcgcgcgcgaactt
gatgtcgatctgacgaaagtgaaaggcacgggcaacaaggggcggatcaccaaggaggat
gtaaaggctttcattgcgcggagcggaacgccagcgggatcgggcgcggcaatgtccggc
attccggaaatcccgccgcaggattttgcgaagtatgggcctgtcgagacgaagccgatg
tcgcgtttgaagcggctgaccggtcccaatctgcatcgcgcgtggctcaacgtcccgcac
gtcaccaactcggacgatgccgatatcaccgatctcgaagcctatcgcaaagaactcgac
gcgacggcaaagacgaagggctatcgagtgacgcttgtcgcgtttctgctgaaggcttcc
gtctcggcattgaaggagtatcccgaggtcaacgcgtcgctcgcgccgggcaaggatgcg
ctgatcctgaagcgctattacaacatcggcgtcgcggtcgacacgccggatggactagtc
gtgcccgtgatcaaggatgtcgaccgcaagggcatcctggaactcagtcaagagttgacg
gcggtatcggcgcggatgcgcgacggcaagattacgccagcggatattcagggcgcgacg
ttctcgatttcgagcctcggcggcatcggcggcacgaacttcacgccgatcgtcaatgca
ccggaagtcgctattctcggcgcagtgcgcgcgcagatgaagccggtttgggatggctcg
acatttcagcctcggctgatgctcccgctgtgcctgtcctacgatcaccgcgtggtcgac
ggcgcgcttgcagcgcgcttcctgcgcaagatctgcgatgcgctggcagatgtgcggcag
ctggtgctatag

DBGET integrated database retrieval system