KEGG   Hyphomicrobium sp. MC1: HYPMC_0545Help
Entry
HYPMC_0545        CDS       T01557                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HYPMC_0545 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HYPMC_0545 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HYPMC_0545 (trpB)
Enzymes [BR:hmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HYPMC_0545 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
534925..536166
Genome map
AA seq 413 aa AA seqDB search
MATTSTKAAEAALNSFATGPDERGFFGIFGGRFVAETLMPLILDLERAYEAAKVDAEFQR
ELNNLSLTYAGRPSPLYYAERMTAELGGAKIYFKREELNHTGSHKINNCLGQILLARRMG
KTRIIAETGAGQHGVATATVCAKYGMPCEIYMGATDVERQAPNVARMALLGAKINPVTSG
AGTLKDAMNEALRDWVTNVRDTYYLIGTAAGPHPYPAMVRDFQAIIGREVREQMMEAEGR
LPDTLVACIGGGSNAIGLFHPFLDDKDVAIYGVEAGGHGVDVENGHAASMTGGSPGVLHG
NRTYLLQDSDGQILEGHSISAGLDYPGVGPEHSWLKDIGRVTYVPATDTEALDALTFCTR
LEGIIPALESSHALAHVKKLAPTLPKDHLLVVNISGRGDKDLATVAKHLGMKI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacatcgacgaaggcggcggaagccgcgctcaacagtttcgcaacaggaccg
gacgagaggggctttttcggcatcttcggcggccgcttcgtcgccgaaacgctgatgccg
ctgatccttgatctcgaacgcgcctacgaggcggcgaaggtggatgcggaatttcagcgc
gagctgaacaatctcagcttgacgtatgcggggcgcccgagcccgctctattacgcggag
cgcatgacagcggagcttggcggcgccaagatctatttcaagcgtgaagagctcaatcac
accggctcgcacaagatcaacaattgccttggccagatcctgctggcgcggcgcatgggc
aagacgcgcatcatcgcggaaaccggtgcaggtcagcacggcgttgcgacggcgacggtc
tgtgcgaagtacggcatgccgtgcgagatctacatgggtgcaaccgacgtcgagcggcag
gcgccgaacgttgcgcgcatggctctcctcggcgccaagatcaatcccgtcacctctggt
gcaggcacgctgaaagatgcgatgaacgaagcgctgcgcgactgggtaacgaacgttcgc
gacacatattatctcatcggtacggcggcaggtccgcatccctatccggcgatggtgcgc
gatttccaagcgatcatcggccgggaagtgcgcgagcagatgatggaggcggaaggccgt
cttccggatacgctggtcgcgtgcatcggtggtggctcgaatgccatcggactgtttcat
ccgttcctcgatgataaggacgtcgcgatctatggcgtcgaagcgggcggtcacggggtc
gatgtcgagaacggccatgcggcgtcgatgacgggtggctcgccgggcgttctgcacggc
aatcgcacgtatctcttgcaggatagcgacggacagatcctcgaagggcattcgatttcg
gcgggcctcgattatccaggcgtcgggccggaacattcgtggctgaaggatatcggccgc
gtgacctacgttccggcgaccgacacggaggcgcttgatgcgctgacgttctgcacgcgg
cttgagggcatcattccggctctcgagtcgagccacgcgctggcgcatgtgaagaagctc
gcgccgacgttgccgaaggaccaccttctcgtcgtcaatatttctggccgcggcgacaag
gatctggccacagtcgcgaagcatctaggcatgaagatctga

DBGET integrated database retrieval system