KEGG   Hyphomicrobium sp. MC1: HYPMC_0546Help
Entry
HYPMC_0546        CDS       T01557                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit (EC:4.2.1.20 4.1.2.8)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HYPMC_0546 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HYPMC_0546 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HYPMC_0546 (trpA)
Enzymes [BR:hmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HYPMC_0546 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
536169..536999
Genome map
AA seq 276 aa AA seqDB search
MTKHETRIDARFAALKKQKRKALITFVTAGDPDLETSAAILDDLVKAGADIIELGMPFSD
PMADGPAIQASSQRALKAGQNMIKTLEMVRAFRTKDDATPIVLMGYYNPIYVYGNERFIK
DAKAAGVDGLIVVDVPPEADDELCLPALKAGLNFIRLATPTTDAKRLPAVLQNTSGFVYY
VSITGITGAAAPVVNDVHNEVKRIKSATPLPVVVGFGVRTGEQARAIARGADGVVVGSAI
VSAIEKSLGSKGEPSGTTCESVSRLVRELSSALSAD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcacgagacacgcatcgacgcgcgctttgcggcgctgaagaaacagaagcgc
aaggcgttgatcacgtttgtgacggcgggcgatcccgacctcgaaacgagcgcggcgatt
ttggacgatctggtcaaagcaggggccgacatcatcgagctcggcatgccgttttccgat
ccgatggcggacggtccggcgatccaggcgtcctcgcagcgggctctcaaggccggccaa
aacatgatcaagacgctcgaaatggtgcgggcatttcgcaccaaggatgatgcgacgcca
atcgtactgatgggctactacaacccgatctacgtctacggcaacgagcgcttcatcaag
gatgcgaaggcggcgggcgtcgatggtctgatcgtcgtcgatgtgccacccgaggccgac
gacgagctgtgtctgccggcgcttaaggccgggctgaacttcatccggctcgcaacgcca
acaacggacgcgaaacgtcttccagcggtactgcagaacacgtcaggttttgtttactac
gtgtcgatcaccggcatcaccggggccgccgcgcccgtagtgaacgatgttcacaatgag
gtgaagcggatcaaaagcgcgacaccgctgccggttgtggtgggctttggcgtccggacc
ggcgagcaggcgcgggcaattgcccggggagcagacggcgtcgtggtcggctcggctatt
gtgtcggccatcgaaaagtctttaggatcaaagggtgagccaagcgggacgacctgcgag
agcgtttctcgactggtccgtgaattaagctcggcactaagcgccgactag

DBGET integrated database retrieval system