KEGG   Hyphomicrobium sp. MC1: HYPMC_0630Help
Entry
HYPMC_0630        CDS       T01557                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HYPMC_0630 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HYPMC_0630 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(622938..623507)
Genome map
AA seq 189 aa AA seqDB search
MTMDSFEFTKLAGAVLSALLLIFGTRTIIEMTVGHTPEKPGFTLPAAAPAETATPPAGGA
AAPAAPAEDSGKEVIALLPKANAEKGKTIFKRCQACHVSEKGQTPTVGPNLWDVVNRKKG
SYPGFKYSAAMEKKGGDWSFDDLAHFLHSPKTFIPGTKMTFNGLPTPQDEADVIAYLATL
ADTPVPLPK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggacagtttcgaattcacgaaacttgccggggccgtgctgtctgcactgctt
ttgattttcggaacccgcacgatcatcgagatgaccgttggtcatacgcccgagaaaccg
ggcttcacccttcctgccgccgcgcccgctgaaacggcgaccccgcctgcaggtggtgca
gcagcgcctgctgccccggccgaagacagcggcaaagaggtgattgcgcttctgcccaag
gcgaacgccgaaaaaggcaagacgattttcaaaagatgccaagcttgtcacgtatccgaa
aaaggccagacgccgaccgtcggcccgaacctgtgggacgtggtaaatcgcaaaaaaggc
tcatatcccggatttaaatattcggcagcgatggagaaaaaaggcggcgactggtcattc
gacgacttggcgcattttcttcacagccccaagacgttcatccccggcacaaaaatgacg
ttcaacggcttgccgacaccgcaggatgaagccgacgtcatcgcctatctcgccaccctt
gcagatacgcccgttccactgccaaaatga

DBGET integrated database retrieval system