KEGG   Hyphomicrobium sp. MC1: HYPMC_0635Help
Entry
HYPMC_0635        CDS       T01557                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HYPMC_0635 (recR)
DNA repair and recombination proteins [BR:hmc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HYPMC_0635 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628042..628659
Genome map
AA seq 205 aa AA seqDB search
MNWDMSRKTAGPEIERLVQLLARMPGLGPRSARKAVLALLKRRNDLMLPLADALQQAIAK
ITECSICGNLDTVSPCSVCADPRRDTSLIVVVEEVGDLWALERASIVSARYHVLGGHLSP
LDGVGPERLNIANLVARAQSPDVKEILLALNATVEGQSTAHYISDQLQSTDVTVSRLAQG
VPIGGELDYLDDGTLAAAFKARRKL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggacatgtctcgtaaaaccgcaggtcctgaaatcgagcggctggtgcagctc
ctggcacgcatgccggggctcgggccgcgttcggcgcgcaaggctgtgctggcgctgctc
aagcggcgcaacgatctcatgttgccgttggcggacgcgcttcagcaggccatcgcgaaa
atcacggaatgctccatttgcggcaatctcgatacggtgtcgccatgcagcgtctgtgcc
gatccgcggcgtgatacgagtctgatcgtcgtcgtggaagaggtcggcgatctttgggcg
cttgaacgggcgagcatcgtttccgcgcgctatcatgtgctcggcggacacttatcgccc
ctcgacggcgtcgggccggagcggctcaatatcgcgaacctcgttgcgcgggcgcaatcg
ccggatgtgaaggaaattctgctggccctgaatgccaccgtcgaaggccaatcgacggca
cattacatctcggatcagcttcagagtaccgacgttactgtttcgcggctggcgcaaggt
gttcccatcggcggtgaactcgattatctcgacgacggcacgctggccgccgccttcaag
gcccggcggaaattataa

DBGET integrated database retrieval system