KEGG   Hyphomicrobium sp. MC1: HYPMC_0658Help
Entry
HYPMC_0658        CDS       T01557                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hmc00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hmc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649470..650762
Genome map
AA seq 430 aa AA seqDB search
MDRIRIVGGHALRGSIPISGAKNAALPLLIASLLTEDRLTLKNVPNLADVNLLVRILRNH
GVDLAVDGKRSSPSGHLGDTIHLTARDIVDTTAPYEMVSRMRASFWVLGPLIARMGEARV
SLPGGCAIGTRPVDLHLTGLKALGAEIDIDSGYVVAKAPKGLRGAHIVFPKVSVGATHNV
LLAAALAKGETVIENAAREPEIGDVATCLTKMGAHVEGIGTSVLRIQGRDRLEGAVHTVL
PDRIETGTFAMAVAATGGDVLLEGAHIHDLKTALDVLGETGTSVEATETGVRIARNGGGI
RPVSVETQPFPGFPTDLQAQLMALLTCASGTSVIRETIFENRFMHVQELARLGADIQLHG
DTATIKGVKALKGAPVMATDLRASVSLVIAGLAGEGETVINRVYHLDRGFEQLERKLSAC
GAEIERLSSG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcggatcagaattgtcggcggccacgcgcttcggggaagcatcccgatttccggc
gccaagaatgcggccttgccgctgctgatcgccagccttttgacggaagaccgcctgacg
ctgaagaacgtccccaatctcgcggacgtcaatcttctggtgcggatcctacgtaatcac
ggcgtcgaccttgccgtcgatggcaagcgttcgagcccgtcgggccatctcggtgacacc
atccatctgacggcgcgcgacatcgtcgatacaaccgcgccctatgaaatggtgtcgcgg
atgcgggcgagcttctgggtgcttggtccgttgatcgcccgaatgggtgaggcgcgggtg
tcgctgcccggcggttgcgccatcggtacacggccggtcgacctgcatctcacggggctc
aaggcgctgggtgccgagatcgacatcgacagcggctacgtcgtcgccaaggcacctaag
ggacttcgcggcgcgcatatcgtatttccgaaggtatcggtcggcgccacgcataatgtg
ctgttggctgccgctctcgccaagggcgagaccgtgatcgagaatgcagcgcgcgagccc
gagatcggcgacgtggcgacgtgcctcacgaaaatgggcgcgcatgtcgaaggtatcggc
acgtcagtgctgcgcattcagggccgcgatcggctcgaaggcgcagtgcatacggtgctg
cccgaccgtatcgaaaccggaacgttcgcgatggcggtcgcggcgacgggcggcgatgtg
ctgctcgaaggcgcgcacattcacgatctcaagactgcgctcgatgtgctgggcgagacg
ggcacgtcggtcgaggcgacggaaaccggcgtgcgcattgcgcgcaatggcggcggcatc
cggccggtgtcggtcgagacgcagccgtttccaggatttccgaccgacctgcaggcacaa
ctgatggcgcttttgacgtgcgcatcgggaacgagcgtcattcgtgaaacgatcttcgag
aaccgcttcatgcacgtgcaggaattggcgcggcttggcgcagacatccagctccatggc
gacacggcgacgatcaaaggcgtgaaagcgctgaaaggcgcgcctgtgatggcgacggat
cttcgcgcctctgtgtcgctcgttattgcggggcttgcgggtgagggtgagacggtcatc
aaccgtgtttaccatctggatcgcggcttcgagcaactggagcgcaagctcagtgcctgt
ggcgccgaaatcgagcgtctcagcagcggttga

DBGET integrated database retrieval system