KEGG   Hyphomicrobium sp. MC1: HYPMC_0660Help
Entry
HYPMC_0660        CDS       T01557                                 

Definition
histidinol dehydrogenase HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HYPMC_0660
  Amino acid metabolism
   00340 Histidine metabolism
    HYPMC_0660
Enzymes [BR:hmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HYPMC_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651369..652667
Genome map
AA seq 432 aa AA seqDB search
MPVRLNNNDNGFEAQFAELLGLKREVSVDVDNTVREIIADVRERGDAALVDLTQKFDRLD
LRKAGIAVTADEIEAAYAACSKETLDALTFACNRIAEHHKRQLPTDDRYTDAAGVELGHR
WTAVESVGLYVPGGLASYPSSVLMNAVPAKVAGVPRIVMVVPSPSGDLNPLVLAAAKISG
VSEIYRIGGAQAVAALAYGTETIKPVVKIVGPGNAYVAAAKRQVFGVVGIDSIAGPSEVL
VIADKNNNPEWIAADLLAQAEHDTAAQSILMTDDAEFANAVEKAVKRQLETLPRGNIAGE
SWNTYGATIILGSLGEAVPLADRIAAEHLEIATADAEDLAKRIRNAGAVFIGSVTPEVIG
DYVSGSNHVLPTARSARFSSGLGVLDFMKRTSILKLDAAALSKLGPAAMTLARSEGLEGH
RRSVEIRLEKAG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgcgtctcaacaacaacgataacggtttcgaagcacagttcgctgagcttctt
ggcctcaagcgcgaagtgtcggtcgatgtcgataacacagtgcgcgagatcatcgcggat
gtccgcgagcgtggtgacgcggcgctcgtcgatctgacgcagaagttcgatcgtctcgat
ctcaggaaggccggcattgcggtgacggccgatgaaatcgaggcggcgtatgcggcgtgt
tcgaaagagacgctcgatgcgctgacgttcgcatgcaatcgcattgccgagcatcacaag
cgccaattgcccacggacgatcgctatacggacgccgcgggtgtcgagcttgggcatcgc
tggacggcggtggaatccgttgggctttatgtgccgggcggacttgcgtcgtatccgagc
tcagttctgatgaatgccgtgccggcaaaagttgcgggcgtgccgcgcatcgtcatggtg
gtgccgtcgccgagcggcgatctcaatccgctcgtgctagcggcggcaaaaatttccggc
gtctcggaaatctatcgcatcggcggcgcgcaggccgtggccgcgctcgcttacggcacg
gagacgatcaagccggtcgtaaaaattgtcgggcctggcaatgcctatgtcgcagcggcg
aagcggcaggtgttcggcgtcgttggcatcgattccatcgcgggaccgtcggaagttctg
gtgatcgccgacaagaacaacaatccggaatggatcgccgctgatcttctggcgcaggcc
gagcacgatacggcggcgcagtcgattttgatgacggacgatgcggagttcgcaaacgcc
gtcgaaaaggccgtgaagcgccagctcgaaacgctgccgcgcggaaatatcgcgggcgaa
agctggaacacgtacggcgcgacgatcattctaggatcgcttggcgaggctgtgccgttg
gccgatcggatcgctgccgaacatctggagattgcaaccgcagacgccgaagatctcgcg
aaacgaattcgtaacgcgggtgctgttttcatcgggagtgtgacgccggaagtgatcggc
gattatgtttcgggatcgaaccatgtgttgcctacggcgcggagcgcgcggttctcatcc
gggcttggcgttctcgacttcatgaagcggacgtcgatcctgaagctcgatgcggcggcg
ctgtcaaaacttggccctgctgcgatgacgcttgctcgctcggaagggctcgaagggcat
cggcgttccgtggaaatccggctcgaaaaagcaggttaa

DBGET integrated database retrieval system