KEGG   Hyphomicrobium sp. MC1: HYPMC_0660Help
Entry
HYPMC_0660        CDS       T01557                                 

Definition
histidinol dehydrogenase HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hmc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hmc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651369..652667
Genome map
AA seq 432 aa AA seqDB search
MPVRLNNNDNGFEAQFAELLGLKREVSVDVDNTVREIIADVRERGDAALVDLTQKFDRLD
LRKAGIAVTADEIEAAYAACSKETLDALTFACNRIAEHHKRQLPTDDRYTDAAGVELGHR
WTAVESVGLYVPGGLASYPSSVLMNAVPAKVAGVPRIVMVVPSPSGDLNPLVLAAAKISG
VSEIYRIGGAQAVAALAYGTETIKPVVKIVGPGNAYVAAAKRQVFGVVGIDSIAGPSEVL
VIADKNNNPEWIAADLLAQAEHDTAAQSILMTDDAEFANAVEKAVKRQLETLPRGNIAGE
SWNTYGATIILGSLGEAVPLADRIAAEHLEIATADAEDLAKRIRNAGAVFIGSVTPEVIG
DYVSGSNHVLPTARSARFSSGLGVLDFMKRTSILKLDAAALSKLGPAAMTLARSEGLEGH
RRSVEIRLEKAG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgcgtctcaacaacaacgataacggtttcgaagcacagttcgctgagcttctt
ggcctcaagcgcgaagtgtcggtcgatgtcgataacacagtgcgcgagatcatcgcggat
gtccgcgagcgtggtgacgcggcgctcgtcgatctgacgcagaagttcgatcgtctcgat
ctcaggaaggccggcattgcggtgacggccgatgaaatcgaggcggcgtatgcggcgtgt
tcgaaagagacgctcgatgcgctgacgttcgcatgcaatcgcattgccgagcatcacaag
cgccaattgcccacggacgatcgctatacggacgccgcgggtgtcgagcttgggcatcgc
tggacggcggtggaatccgttgggctttatgtgccgggcggacttgcgtcgtatccgagc
tcagttctgatgaatgccgtgccggcaaaagttgcgggcgtgccgcgcatcgtcatggtg
gtgccgtcgccgagcggcgatctcaatccgctcgtgctagcggcggcaaaaatttccggc
gtctcggaaatctatcgcatcggcggcgcgcaggccgtggccgcgctcgcttacggcacg
gagacgatcaagccggtcgtaaaaattgtcgggcctggcaatgcctatgtcgcagcggcg
aagcggcaggtgttcggcgtcgttggcatcgattccatcgcgggaccgtcggaagttctg
gtgatcgccgacaagaacaacaatccggaatggatcgccgctgatcttctggcgcaggcc
gagcacgatacggcggcgcagtcgattttgatgacggacgatgcggagttcgcaaacgcc
gtcgaaaaggccgtgaagcgccagctcgaaacgctgccgcgcggaaatatcgcgggcgaa
agctggaacacgtacggcgcgacgatcattctaggatcgcttggcgaggctgtgccgttg
gccgatcggatcgctgccgaacatctggagattgcaaccgcagacgccgaagatctcgcg
aaacgaattcgtaacgcgggtgctgttttcatcgggagtgtgacgccggaagtgatcggc
gattatgtttcgggatcgaaccatgtgttgcctacggcgcggagcgcgcggttctcatcc
gggcttggcgttctcgacttcatgaagcggacgtcgatcctgaagctcgatgcggcggcg
ctgtcaaaacttggccctgctgcgatgacgcttgctcgctcggaagggctcgaagggcat
cggcgttccgtggaaatccggctcgaaaaagcaggttaa

DBGET integrated database retrieval system