KEGG   Hyphomicrobium sp. MC1: HYPMC_0740Help
Entry
HYPMC_0740        CDS       T01557                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00040  Pentose and glucuronate interconversions
hmc00052  Galactose metabolism
hmc00500  Starch and sucrose metabolism
hmc00520  Amino sugar and nucleotide sugar metabolism
hmc01100  Metabolic pathways
hmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HYPMC_0740 (galU)
   00052 Galactose metabolism
    HYPMC_0740 (galU)
   00500 Starch and sucrose metabolism
    HYPMC_0740 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HYPMC_0740 (galU)
Enzymes [BR:hmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HYPMC_0740 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CCB63973
UniProt: F8JD96
Position
complement(726011..726907)
Genome map
AA seq 298 aa AA seqDB search
MNAIKKPIRKAVFPVAGLGTRFLPATKAVPKEMLTVVDRPVLQHVVDEARAAGIEHFIFV
TGRNKGVIEDHFDKQFELEATLATRGKKKELEALERDLPQAGQTSFTRQQAPLGLGHAVW
CARELVGNEPFALLLPDMLHHGRTSCLADMIDAYSQTGGNLIAVAPVPEDQTHQYGIVGV
KDVKAKVSAITEMVEKPKPGTAPSNLHITGRYVLQPEVFDLLAKQERGAGGEIQLTDSMI
AMMNGAGQPFHAVRFDGDIYDCGSKLGFLTANVAIALERDDLEKDFRRELKRLIGTNV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatcaagaaaccaattcgcaaagccgtatttcctgttgccggtctcggtacc
cggtttctgcctgcaaccaaggccgtgccgaaggaaatgctgacggtcgtcgaccgtcct
gtgctccagcacgtcgtcgatgaggcgcgcgccgccggcatcgagcatttcatattcgtc
actggacggaacaagggcgtcatcgaagaccatttcgataaacagttcgagcttgaagcg
acgctcgcaacgcgcggcaagaaaaaggagcttgaggccctcgaacgcgacctgccgcaa
gccggtcaaacgagcttcacgcgtcagcaggcgccgcttgggctgggccatgccgtttgg
tgcgcccgcgagcttgttggcaatgaaccgtttgcgttgcttctgcccgacatgcttcac
cacggacgcacgtcctgcctcgccgacatgatcgacgcctattcgcaaaccggcggcaat
ctgatcgcggtcgcgccagtccccgaagatcagacgcaccagtacggtatcgtcggcgtc
aaggatgtgaaggccaaagtctccgcaatcacggaaatggtcgagaagcccaagcccggt
acggcgccgtccaatttgcacattaccggccgctacgtcctgcagcctgaagtattcgat
ctcctcgccaagcaagagcgcggcgccggtggcgaaattcagctgacggactccatgatc
gctatgatgaacggcgccggacagccgttccatgccgtgcgtttcgacggcgatatctac
gactgcggctccaagcttggcttcctcaccgccaatgtcgccatcgctctcgaacgcgac
gacctcgaaaaggacttccgacgcgagctcaagcgtctcatcggcacaaacgtctga

DBGET integrated database retrieval system