KEGG   Hyphomicrobium sp. MC1: HYPMC_0749Help
Entry
HYPMC_0749        CDS       T01557                                 

Definition
lysophospholipase L2 (pldB-like) (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HYPMC_0749
Enzymes [BR:hmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HYPMC_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738394..739365
Genome map
AA seq 323 aa AA seqDB search
MKLVSLSINPVPSGAEVLAFDGYDRRKLRAALWEATRGPVRGTVIIVQGRGEFIEKYFEV
VADLRRRGFAVAIFDLRGQGGSERVLSNRHKGHVVAFTEYDRDLAIFIDEIVRPNLPEPF
VGLGHSLGGNILLRGAQDEASPFSRMILLSPMIDIHERMLGASRPLAKAYASTASMLGLA
TAYVRGGTDQPNDLMAFENNRLTSDYVRWSRVKSIIEAAPDLALGSPTVGWLRAALRSCA
MLSRPDYPKYVCVPMMLFAAGADHVVSMQAIEDFAVDLKSGGHVLMPGSRHEILQETDAI
RQRFWAAFDAYMGVETLPSEGRL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggtttcgctttcgatcaatcccgttccgagcggcgccgaggtattggctttc
gacggctacgaccgccgcaagctgcgcgcggcgctttgggaggccacgcgcgggccggtg
cggggcaccgttatcatcgtgcaggggcgaggcgagttcatcgagaagtatttcgaggtc
gttgccgatctcaggcggcgcggcttcgccgtggcaatcttcgatttgcgcgggcagggt
gggtccgagcgtgtcttgtcgaaccggcataaggggcacgtcgtcgccttcaccgaatac
gaccgcgatctagcgatatttatcgacgagatcgtgcggccgaacctgccggagccgttc
gtcgggcttggtcattcgctcggaggcaacattctgctgcgcggggcgcaggacgaagcg
agcccgttctcgcgcatgattctgctgtcgccaatgatcgacatccacgagcgcatgctc
ggggcgagccgaccgctagcgaaggcttatgcttcgacggcgtcgatgctggggctggcg
accgcctacgttcgcggtggcaccgaccagccgaatgacctcatggcgttcgagaataac
aggctgacgagcgattacgtgcgctggtcgcgggtgaaatcgatcattgaggctgcgcct
gacttggcgctcgggtcgccgacggtcggctggctccgggcggcgctgagaagctgcgcc
atgctttcgcgacccgattatccgaaatacgtgtgcgtgccgatgatgctctttgctgcg
ggcgccgatcatgtcgtttcgatgcaggcgatcgaagattttgccgtcgatcttaaatcc
ggcggccacgttctgatgccgggttcgcggcatgagattctgcaagagacagacgccatc
cggcagcggttctgggccgctttcgacgcctacatgggcgtcgaaacgttgccgtcggaa
ggtcgcctataa

DBGET integrated database retrieval system