KEGG   Hyphomicrobium sp. MC1: HYPMC_0779Help
Entry
HYPMC_0779        CDS       T01557                                 

Definition
glycoside hydrolase 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hmc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:hmc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(768921..770243)
Genome map
AA seq 440 aa AA seqDB search
MIQTVIRALLLAILSAALIVSGGSSSDARSGYHKSGSRKYHKRHSPRYHARNKTRRAKLA
VKAEPAQPALPQRPQKLLTRDEILASDPQRLERLGGRIVVGFDSFSQVKPLVEKKAIAGI
FVTDHNVQGRKIQDVAKDIDDLQMIRRQQGLPRLIVAADQEGGYVSRLSPPLKWQPTLGM
LIAKLKTDSDREKAVRQYAETQARELERLGITMNFGPVVDLRLGKPNRNDGETRIYWRAI
DDDPYLVAKVAGWYCDTLTKFNIICTLKHFPGLGRVTRDTHVTSADISTGASQLELTDWV
PFRRVMTEPGVATMLGHVRLDTIDSTTPASFSDIVINKVVRPRFENDGLLITDDFSMGAV
TKSRDGLGGAAVKALDAGVDLILLCSVDKSYDILMSALIEADQKGEISIARENETRERLK
RYVFVDDRDLPPSAPVQAQQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaactgtgatccgcgccttgctgctcgccattctgtcagccgcactgatcgtg
tcgggcggcagctcgtccgatgcgcgctccggctatcacaaatccggctcgcgcaaatat
cataagcgccactcgccgcgttatcatgcccgcaataaaaccagacgtgccaagctcgca
gtaaaagccgagcccgcgcagccggccttgccgcaacggccgcaaaaacttctgacgcgc
gacgaaatccttgcatccgatccgcagcggctcgaacgtctcggcggacgcatcgtcgtc
ggcttcgatagcttttctcaggtcaagccgctcgtcgagaaaaaggccatcgccggcatc
ttcgtcaccgatcacaacgtccagggccgtaaaattcaggacgtcgccaaagacatcgac
gacctgcagatgatccgccggcagcaaggcctgccccgcctcatcgttgccgccgaccag
gaaggcggatacgtgtcgcggctctcgcccccgctcaagtggcagccgacgctcggcatg
ctcatcgccaagctcaagaccgacagcgatcgcgaaaaagccgtccgccaatatgccgaa
acgcaagcgcgcgaactggaacgcctcggcatcacgatgaactttggccctgtcgtcgat
ctgcggctcggcaagcccaatcgcaacgacggcgaaacccgtatctattggcgcgccatt
gacgacgatccctacctcgtcgccaaagtcgcgggctggtactgcgataccctgacgaaa
ttcaacatcatctgcacgctgaagcatttccccggcttgggtcgcgttacgcgcgacaca
cacgtaacgtcggcagacatcagcaccggcgcaagccagcttgaactgaccgattgggtg
ccgttccgccgcgtaatgacggagcccggcgttgcgaccatgcttggccacgtccggctc
gacaccattgacagcacgacgccggcgtccttctccgatatcgtcatcaacaaggtcgtg
cgtccgcgcttcgaaaacgacggcctgctcatcaccgacgacttcagcatgggcgcagtc
acgaaatcgcgcgacggcttgggcggcgcggccgtcaaagcgctcgatgcaggggtcgat
ctgatcctgctgtgcagcgtcgacaagagctacgacatcctgatgtccgcgttgatcgaa
gccgaccagaagggcgaaatctcaatcgcgcgcgaaaacgagacgcgcgagcggctgaag
cgctacgtcttcgtcgacgatcgcgacctgccaccgtccgctcccgttcaggcgcagcag
taa

DBGET integrated database retrieval system