KEGG   Hyphomicrobium sp. MC1: HYPMC_0779Help
Entry
HYPMC_0779        CDS       T01557                                 

Definition
glycoside hydrolase 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HYPMC_0779
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HYPMC_0779
Enzymes [BR:hmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HYPMC_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(768921..770243)
Genome map
AA seq 440 aa AA seqDB search
MIQTVIRALLLAILSAALIVSGGSSSDARSGYHKSGSRKYHKRHSPRYHARNKTRRAKLA
VKAEPAQPALPQRPQKLLTRDEILASDPQRLERLGGRIVVGFDSFSQVKPLVEKKAIAGI
FVTDHNVQGRKIQDVAKDIDDLQMIRRQQGLPRLIVAADQEGGYVSRLSPPLKWQPTLGM
LIAKLKTDSDREKAVRQYAETQARELERLGITMNFGPVVDLRLGKPNRNDGETRIYWRAI
DDDPYLVAKVAGWYCDTLTKFNIICTLKHFPGLGRVTRDTHVTSADISTGASQLELTDWV
PFRRVMTEPGVATMLGHVRLDTIDSTTPASFSDIVINKVVRPRFENDGLLITDDFSMGAV
TKSRDGLGGAAVKALDAGVDLILLCSVDKSYDILMSALIEADQKGEISIARENETRERLK
RYVFVDDRDLPPSAPVQAQQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaactgtgatccgcgccttgctgctcgccattctgtcagccgcactgatcgtg
tcgggcggcagctcgtccgatgcgcgctccggctatcacaaatccggctcgcgcaaatat
cataagcgccactcgccgcgttatcatgcccgcaataaaaccagacgtgccaagctcgca
gtaaaagccgagcccgcgcagccggccttgccgcaacggccgcaaaaacttctgacgcgc
gacgaaatccttgcatccgatccgcagcggctcgaacgtctcggcggacgcatcgtcgtc
ggcttcgatagcttttctcaggtcaagccgctcgtcgagaaaaaggccatcgccggcatc
ttcgtcaccgatcacaacgtccagggccgtaaaattcaggacgtcgccaaagacatcgac
gacctgcagatgatccgccggcagcaaggcctgccccgcctcatcgttgccgccgaccag
gaaggcggatacgtgtcgcggctctcgcccccgctcaagtggcagccgacgctcggcatg
ctcatcgccaagctcaagaccgacagcgatcgcgaaaaagccgtccgccaatatgccgaa
acgcaagcgcgcgaactggaacgcctcggcatcacgatgaactttggccctgtcgtcgat
ctgcggctcggcaagcccaatcgcaacgacggcgaaacccgtatctattggcgcgccatt
gacgacgatccctacctcgtcgccaaagtcgcgggctggtactgcgataccctgacgaaa
ttcaacatcatctgcacgctgaagcatttccccggcttgggtcgcgttacgcgcgacaca
cacgtaacgtcggcagacatcagcaccggcgcaagccagcttgaactgaccgattgggtg
ccgttccgccgcgtaatgacggagcccggcgttgcgaccatgcttggccacgtccggctc
gacaccattgacagcacgacgccggcgtccttctccgatatcgtcatcaacaaggtcgtg
cgtccgcgcttcgaaaacgacggcctgctcatcaccgacgacttcagcatgggcgcagtc
acgaaatcgcgcgacggcttgggcggcgcggccgtcaaagcgctcgatgcaggggtcgat
ctgatcctgctgtgcagcgtcgacaagagctacgacatcctgatgtccgcgttgatcgaa
gccgaccagaagggcgaaatctcaatcgcgcgcgaaaacgagacgcgcgagcggctgaag
cgctacgtcttcgtcgacgatcgcgacctgccaccgtccgctcccgttcaggcgcagcag
taa

DBGET integrated database retrieval system