KEGG   Hyphomicrobium sp. MC1: HYPMC_0850Help
Entry
HYPMC_0850        CDS       T01557                                 

Gene name
ccpA
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hmc  Hyphomicrobium sp. MC1
Brite
Enzymes [BR:hmc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HYPMC_0850 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(828404..829444)
Genome map
AA seq 346 aa AA seqDB search
MRLFTILTVVATSAVAMSVDAADDPLMKQAQATFAPIPLTPPVIKGIVSTPAMVDLGKAL
YFDPRLSQSHNISCNTCHQIGLGGVDMLPNSIGHKWQHGGRNAPTVLNAVFNVAQFWDGR
AADLKAQAGGPIQNPIEMGITPEHAIQMLKGIPGYSKLFEAAFATDADRITMSNVATAIA
AFEATLITPNAPFDKYLRGDEAALTPEQKEGLQLFMSKGCSSCHAGINVGGQMYAPFGVV
EKPGADFLPPDDKGRFQVTHTVSDEYVFRVPPLRNVALTMPYFHTGKSWDLRQAVAVMGT
SQLGQHLTDAEISNITSFLESLTGEQPQVTYPILPPSTVETPRPQP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgactatttacaattctgacagtggtcgcgacttctgcggtcgcgatgtcggtggat
gctgccgatgaccctctcatgaagcaggcccaagccaccttcgctcctattcctctcacc
ccgccagtgattaaaggcattgtctctacgccagcgatggtggacctcggcaaagctctc
tatttcgatccgcgcctttcgcaaagtcataacatcagctgcaacacctgccatcaaatt
gggcttggaggcgtcgacatgcttccaaactcgattgggcacaaatggcaacacggcggc
cgaaatgcacccacagttttgaatgcagtatttaacgtcgcgcaattttgggatggccgc
gccgctgacttgaaagcccaagctggtgggccgatccagaatccaatcgagatgggcatc
acccccgaacacgctattcaaatgttgaaaggaattcctggctacagcaagctttttgaa
gcggccttcgctactgacgccgatcgcattacgatgtccaacgtcgcaaccgcgattgcg
gcctttgaagcgacgctgatcacccccaatgctcccttcgacaagtatttgcgaggcgat
gaagcagcgcttactccagagcaaaaagaaggtttgcagctcttcatgagcaagggatgc
tcgtcctgtcatgcgggcataaatgtcggcgggcaaatgtatgcgccctttggcgtagtc
gaaaaaccaggtgctgatttcctgccgcctgatgataaggggcgcttccaagtcacgcac
acggtcagcgatgaatatgtctttcgcgtcccgccgctccgtaatgttgcgctgacaatg
ccatatttccatacggggaaatcatgggatcttcgtcaggcagttgctgtcatgggcaca
agccaactcggccaacacctcacggacgcggaaattagcaacatcacctcgttcctggag
tcgctgacgggcgagcaaccccaagtcacctacccgatactcccgcccagtacggtagaa
acgcctaggccgcagccataa

DBGET integrated database retrieval system