KEGG   Hyphomicrobium sp. MC1: HYPMC_1020Help
Entry
HYPMC_1020        CDS       T01557                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985794..986951
Genome map
AA seq 385 aa AA seqDB search
MFRGRFFMSYAHGQAHTGMRRSIYLQPTAIFWDRSERRAVDEADVAQWKGLPLAGGRLSF
AALDVLTRSSPNTKRRTVVLGDAFSGDWGREALAAADILQELSEPRARLAGMSLDRPRIM
GIVNVTPDSFSDGGEFASTRDAVEHGLRLIEQGADILDIGGESTRPQADYVAVEEELRRV
IPVIEGLRAKTDAVISVDTRKSEVMKRAAAAGADILNDVSAFTHEPDALEVAAETGLPVI
VMHAQGDPKTMNDNPQYDDVVLDVFDYLESRVQACIAAGIPKSKIVADPGIGFGKHLHHN
VAVMAGLSLYHGLGVPLLLGASRKKMIGQLCNVDGAKNRVPGSLACAIAGVAAGVQMVRV
HDVAETKQAVEVWRACSAGTEKGLD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgtttcgcggccgctttttcatgagttacgcgcacgggcaggcacacaccggaatgaga
cgctcaatctatctgcaacccaccgccatcttctgggaccggagcgagcggcgcgccgtc
gacgaagccgacgtggcccagtggaagggtctgccgctggcaggcggacgcctgtcgttt
gctgcgctcgacgtgctgacgcgtagctcgcctaacaccaaacggcgaacggtcgtgctc
ggtgatgccttcagcggcgattgggggcgggaagcgctggctgctgccgatattctgcag
gagctttcggaaccgagggcgcggcttgccggtatgtcgctcgaccggccgcgcatcatg
ggcatcgtgaatgtcacgcccgacagcttttccgatggcggcgagtttgcttcgacgcgc
gatgcagtcgagcacggtctgcgtttgatcgaacagggtgccgacattctcgatatcggc
ggcgagagcacgcgaccgcaggctgactatgtcgctgtcgaagaagagttacgacgcgtc
attccggtgatcgaagggctgcgggcaaagaccgatgccgtcatttcggtcgatacgcgc
aagtctgaggtcatgaagcgcgcggcggcggcgggagctgatattctgaatgacgtctcc
gccttcacgcacgaaccggacgcgctggaggttgctgccgagacggggctgccggtcatc
gtcatgcacgcgcaaggtgatccgaagacgatgaacgacaatcctcagtacgacgatgtc
gtgctcgacgtgtttgattatctggaaagccgcgtgcaggcgtgcatcgcggccgggatt
ccgaagtcgaaaatcgtcgccgatccgggcatcggcttcggcaagcatctgcatcacaac
gtggcggtgatggcggggttgtcgctctatcatgggctcggcgtgccgctgcttctcggc
gcgagccgtaagaagatgatcggtcagctctgcaacgtggatggtgccaagaaccgggtg
ccgggttctctggcctgcgccatcgccggggttgcggcaggcgttcagatggttcgcgtg
cacgacgtggcggaaacgaagcaggccgtcgaggtctggcgggcgtgctcggcaggaacg
gagaaaggactggactga

DBGET integrated database retrieval system