KEGG   Hyphomicrobium sp. MC1: HYPMC_1353Help
Entry
HYPMC_1353        CDS       T01557                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HYPMC_1353
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HYPMC_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1271924..1272298
Genome map
AA seq 124 aa AA seqDB search
MRAIFAGCAIALSPMLIETAFAAEEVGPEAFNNNCRTCHSWKEGDNRLGPTLHGIIGRKA
GTAEGFNYSSAMKSSGITWDEATLDKFITNPNAVVPNNNMKPFSGVGDAATRKQIIDFLK
SNPK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatatttgctggctgtgcaatcgcattgtcgccgatgctgatcgagacggcg
tttgcggcggaagaggttgggccggaagcgttcaataacaattgccggacctgccattcg
tggaaggagggcgacaatcgcctcggcccgaccttgcacggcattatcggccgtaaggct
ggaacggctgagggcttcaattattcgagtgcgatgaagtcgtcaggcatcacgtgggat
gaggcgacgctcgacaaattcatcaccaacccgaatgcggtcgttcccaataacaacatg
aagccgttcagcggcgtcggcgatgcggcgacgcgcaaacagatcatcgattttctgaaa
agcaatccgaagtga

DBGET integrated database retrieval system