KEGG   Hyphomicrobium sp. MC1: HYPMC_1390Help
Entry
HYPMC_1390        CDS       T01557                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hmc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303109..1305151)
Genome map
AA seq 680 aa AA seqDB search
MCGIFGIIDLKSRRSVPLSVLKRAADAMLHRGPDEDGYLQRPGFGFASRRLSIVGLADGQ
QPVFNEDKSIAAVFNGEIFDHDDWRQQLRSLGHTLTTHCDTELFPHMWEQYGEDMFEKFN
GQFAVALFDERKQKFILARDRFGICPLYWTRTTRFGTDWLVFGSEIKTILATGLVEAKPD
PRGIDALFNYLAIPGPASCFEGINILPPGKFLTISRGRVGEEATIDERTYWRMDFPDMGK
ETRFADEEKLVNDFERVLYDAVKRRLRADVPVASYLSGGVDSSTVVAMAKDILGAAPTTF
TVKIRDPKLDETEQAAIISKHLSADPYVVACGSEEIVSNYQRLLVATEAPVTDTSCTALM
MLAAKVKDTGFKVALTGEGSDEWLAGYPWYKFDRIIEMMGKVSGGTLPPKMQRYFHRWLG
CNDEAMAYLDKCATSSGGMHPFQRFYDLLGASRFRFYSTGMMAGLSDHDPYLAIDPDSSR
AAKWHPVNRGVYWAGKIHLPGQLLSLKGDRIAMSQSVEMRYPFLDNNVFDFLAGIDPKWK
LKGLTEKYLLRRVAEKWLPKSVAWRPKGMFRAPLDGFFLEQRLPYVDELLSDESIKKAGY
FDPKAVAKWRNEYKDLSWWGYQRQSGELGLVAVLATQLWHHTYIDPTLANLPDWRSIAGV
PSEWSDLDFAETSGVEESVA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatttttggaattatcgacctcaagagccgacgctcggtaccgctatcggta
ttgaagcgcgccgccgatgccatgctgcatcgtggcccggacgaagacggttatcttcag
cgccccggcttcgggttcgcctcgcgccgcttgagcatcgtcggccttgccgacggccag
cagcctgtcttcaacgaagacaaatccatcgctgccgtcttcaacggcgaaatcttcgat
catgacgattggcgtcagcagcttcgcagtcttggccacacgctgacgacccactgcgat
actgaactcttcccgcacatgtgggagcagtacggcgaggacatgttcgaaaagttcaac
ggccagtttgccgtcgcactgttcgacgagcgcaagcagaagttcattcttgcccgcgat
cgtttcggtatttgcccgctttactggacgcgcacgacgcgcttcggtaccgactggctc
gtcttcggttccgaaatcaaaacgatcctcgccaccggcctcgtcgaggcgaagcccgac
ccgcgcggcatcgatgctctcttcaactatctcgccattccaggaccggcgagctgcttc
gaagggatcaacatcctgcctccgggaaagttcctgaccatttcgcgcggccgcgtcggc
gaagaggcgacgatcgacgagcgcacctactggcggatggacttccccgacatggggaaa
gaaacgcgctttgccgatgaggaaaagctcgtcaacgatttcgaacgcgtcctctacgat
gctgtgaagcgtcgtctgcgcgccgatgttccggtcgcctcgtatctctcgggcggcgtc
gactcgagcactgtcgtcgcgatggcgaaagacattctcggcgccgcaccgacgacgttc
accgtcaagatccgcgacccgaagctcgacgaaaccgagcaggcagcaatcatctccaag
catttgtccgccgacccgtatgtcgtcgcctgcggatcggaagagatcgtctcgaactat
cagcgcttgctcgtcgccactgaagcacccgtcaccgatacgtcgtgcaccgccttgatg
atgctcgccgcaaaagtaaaggacaccggcttcaaggtcgcgctgaccggcgaaggttcc
gacgaatggctcgccggctacccgtggtacaaattcgatcgcatcatcgaaatgatgggc
aaggtctcaggcggcactctgccgccgaagatgcagcgctatttccatcgctggcttggc
tgcaacgacgaggcgatggcctatctcgacaagtgcgccacgtcttcgggcggcatgcat
ccgttccagcgtttctacgatcttctcggtgcctcgcgcttccgcttctacagcaccggc
atgatggccggcctgtcggaccacgatccttatctggcaatcgaccccgacagcagccgg
gcggcgaagtggcatccggtgaaccgcggcgtgtactgggcaggtaagatccatcttccc
ggccagctcctgagcctcaagggcgaccgcatcgcgatgagccaatcggtcgaaatgcgc
tatccgttcctcgacaataatgtcttcgacttccttgcgggcatcgatccgaaatggaag
ctcaaaggcctgacggagaaatatctgctccgccgcgtcgccgagaagtggttgccgaag
tccgtcgcatggcggccgaagggtatgttccgcgccccgctcgatggcttcttcctcgaa
cagcgcctgccctacgtcgatgagctgctcagcgatgagtcgatcaagaaggccggatac
ttcgatccgaaagccgtcgcaaagtggcgcaacgaatacaaggatctctcctggtggggc
tatcagcgccaatcgggtgagcttgggctcgttgccgttctcgcgacccagctttggcat
cacacctatatcgacccgacgctcgccaaccttcccgactggcgctcgatcgcgggtgtg
ccgtcggaatggagcgatctcgatttcgccgagacgagcggagttgaagaaagcgtcgcg
tga

DBGET integrated database retrieval system