KEGG   Hyphomicrobium sp. MC1: HYPMC_1587Help
Entry
HYPMC_1587        CDS       T01557                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01130  Biosynthesis of antibiotics
hmc01230  Biosynthesis of amino acids
Module
hmc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HYPMC_1587 (trpC)
Enzymes [BR:hmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HYPMC_1587 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CCB64817
UniProt: F8J803
Position
complement(1505756..1506553)
Genome map
AA seq 265 aa AA seqDB search
MADILDKITAYKLDEVARAKTIKPLRVIAEYARSAPHVRPFADAIAAKHAKKKPALIAEV
KKASPSKGLIRADFDPPALAKAYEAGGAACLSVLTDRPSFQGAPEFLTAAREATSLPVLR
KDFMIDTYQVAEARAWGADCILIILAEVDDATAHDLAEAAKDWGMDAIAEVHNAAELERA
LKLDCRLVGINNRNLKTFEVTLKTTEDLAPQVPADRIIVGESGIFTPADLARLSKVGVNT
FLVGESLMRQSDVTAATKTLLAPVS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcctcgacaaaatcaccgcatacaagctcgatgaggtcgcgcgcgcgaag
accatcaagccgctgcgcgtcattgccgaatacgctcgctccgcaccgcacgtacgcccg
tttgccgatgccattgcggcgaagcatgcgaaaaagaaaccggcgctcatcgccgaggtc
aaaaaggcctcaccttcgaaaggcctgatccgcgccgacttcgatcctcctgcgcttgca
aaagcctatgaggccggcggtgcggcttgcctctcagtgctgaccgatcggccgtcgttc
cagggtgcgcccgaattcctgacggcggcgcgcgaagcaacctcgcttcccgttctgcgc
aaggacttcatgatcgatacctatcaggtcgccgaagcccgcgcctggggcgccgactgc
atcctgatcatcctcgccgaagtcgacgacgcgacggcccacgacctcgccgaagcggcg
aaagactggggcatggacgccatcgccgaggtccacaacgccgccgagcttgaacgcgcg
ctaaaactcgactgtcgcctagtcggcatcaacaatcgcaatctcaaaacgttcgaagtg
acgctcaagacgacggaagatctggcgccgcaagtgccggccgatcgcatcatcgtcggc
gaaagcggtattttcacaccggctgatcttgcgcgtctttcaaaggtcggcgtcaatacc
ttcctggtgggcgaaagcctgatgcggcagtccgacgtgacggccgcgaccaaaaccctg
ctcgcgccggtgtcatga

DBGET integrated database retrieval system