KEGG   Hyphomicrobium sp. MC1: HYPMC_1633Help
Entry
HYPMC_1633        CDS       T01557                                 

Gene name
cycA
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:hmc00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:hmc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1544097..1544453)
Genome map
AA seq 118 aa AA seqDB search
MRKWVLAIAMIAVAPSAGMAADAAAGEKVFAKCKACHQVDKNGVGPHLGGLIGRKAGSVE
GYNYSEALKKSGITWDEASLDKWLQGPSKDVPGTKMIFPGVKDATQRADLIAYLATLK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagtgggttctggcgatcgcaatgatcgctgttgcaccgagcgctggcatggcc
gctgatgcggctgccggcgagaaggtctttgcgaaatgcaaggcttgtcaccaagtcgac
aagaacggcgttggcccgcacctcggcggcttgatcggccgtaaggctggttcggttgaa
ggctacaactactctgaagccctgaagaagtcgggcatcacgtgggatgaagcttcgctc
gacaagtggctccagggcccgagcaaggacgttcccggcacgaagatgatcttcccgggc
gtcaaggatgcaacgcagcgcgccgatttgatcgcgtatctcgcgacgttgaagtaa

DBGET integrated database retrieval system