KEGG   Hyphomicrobium sp. MC1: HYPMC_1982Help
Entry
HYPMC_1982        CDS       T01557                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HYPMC_1982 (cysQ)
Enzymes [BR:hmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     HYPMC_1982 (cysQ)
Transfer RNA biogenesis [BR:hmc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    HYPMC_1982 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1886298..1887122
Genome map
AA seq 274 aa AA seqDB search
MLDTLERIAIEAGTLIAKIRQGGANVMTKSDGSPVTDADQAAEDLIVRALQRVAPDIPII
AEESAASCVADHSTSRALFFVDPLDGTKEFIRGRPDYTVNICLVENRKPKLGVVFAPARG
ELFSSDGLASYRSAILQDASIGERSQIRASCGDGRLTAVASASHGNVETEDFLQKLPVDR
KVSVGSSLKFCLVAMADAHIYPRFGRTMQWDTAAGDAVLRGAGGCTLTSDGRELEYGVPC
AADGSYDNPHFISYGGDAETLRTLLQNCSGVIDA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatacgctcgaacgcattgccatcgaggccggcacactcattgccaaaattcgg
caaggtggcgccaacgttatgaccaagtccgacggcagtccggtgacggatgccgatcag
gcggcggaagatctgatcgtgcgcgcgctgcagagggtcgcgccggatattccgatcatc
gcggaagaatctgccgcttcttgcgttgcagatcattcaacaagccgcgcgctgtttttt
gtcgatccgctcgatgggacaaaagagttcattcgtggcaggccggattatacggtcaac
atctgcctcgtcgaaaaccggaagccgaaactcggcgtcgtcttcgcgccggcgcgtggc
gagttgtttagcagtgacggcttggcatcttaccggtccgcaattttgcaagatgcttcg
attggtgagcgctcgcaaattcgcgcgtcatgtggagatggccgcctaaccgccgtcgcg
agtgcttcgcacggaaatgtggaaacggaagattttctgcagaagctcccggtcgatcgc
aaggtctcggttggctcgtctttgaagttctgtctcgtggcgatggcggacgctcatatc
tatccgcgtttcggtcggacgatgcagtgggacaccgcggcgggggatgcggtcttgcgc
ggtgccggtggctgcacgctgacgtcggacggcagagaactcgaatacggcgtgccgtgc
gcggcagacgggtcttacgacaatccgcatttcatctcgtacggcggcgatgcggagacc
ctgcggacgctgctgcagaattgcagcggcgtgatcgacgcgtag

DBGET integrated database retrieval system