KEGG   Hyphomicrobium sp. MC1: HYPMC_2233Help
Entry
HYPMC_2233        CDS       T01557                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HYPMC_2233
  Amino acid metabolism
   00300 Lysine biosynthesis
    HYPMC_2233
Enzymes [BR:hmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HYPMC_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2110780..2111991)
Genome map
AA seq 403 aa AA seqDB search
MPDAIELTRELIRFNTVNPPGNELIALAHLKKILIDNGFQVECREFGNNRANIIARRGKH
IGANEGEMPICFTGHLDTVPLGSIPWKVDPFGAEIVGERLFGRGASDMKSGVAAMVAAAI
GSRDVLDEGPGIVLILTSGEETGCEGAAHLTTHVDLGPIGAIVVGEPTGNAPRSGHKGAL
WLVASSFGQTAHGSMPELGVNAIFRSIKLLSKLQDFDFNRKPHAGLGKPTLNVGRMNSGS
NVNSVPDHSEIWIDVRTIPGMQHHDVREHFSSYLAPELDKLEPVVDLESVWTEADNPWLR
SICRMIDTADLSQPSGVPFFTDASVLAPALGNPPVLILGPGETAQAHQTDEFCFVDKIPD
AVTIYRRIIEDWQANPVSPSSRLNELEQVAANARATGKSRQST
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgacgcaatcgagctcaccagagagctaattcgcttcaatacggtcaatccgccg
gggaacgaattaattgcgctagcccatctcaaaaaaattctcattgataacggctttcaa
gtcgagtgccgcgaatttggaaacaatcgtgccaatataattgcaagacgcggcaagcat
atcggcgcgaatgaaggggaaatgccgatttgctttaccgggcacttggataccgtcccg
ctcggaagcatcccttggaaggttgatcccttcggcgcggaaattgttggcgagcgactg
ttcggtagaggcgccagcgatatgaaatccggagttgccgctatggtggcggcggcgatc
ggctcgcgtgatgttttggacgaaggccctggaatcgtcctgatcctgacgtcaggggaa
gaaacgggatgcgagggtgcagcgcatctgacgacgcatgtcgatctcggtcccatcggt
gcgattgtcgttggagagccgacggggaacgcaccacgttccggccacaagggcgcactg
tggcttgtcgcaagtagctttggacagacggcccacggctcaatgccggagttgggcgtc
aacgcgattttccgcagcataaaactgctctcgaagctgcaggacttcgatttcaatcga
aaacctcacgcggggctcggcaaacccaccctgaatgtcgggcggatgaatagcggctcc
aatgtcaattccgttccagaccattccgagatttggatcgatgtgcgaacgatccccggc
atgcagcatcacgatgtgagggagcatttctcgagttatcttgcgccggaactcgataag
cttgaacccgtcgtcgacctcgaaagcgtttggacggaggctgataatccatggttgcgc
tcgatctgtcggatgattgacaccgcagatttatcgcagccctcaggtgtcccattcttc
actgacgcaagcgttctggctccagcactcggaaatccgccagtcctcattctcggtcct
ggagaaacagcgcaagcgcaccagaccgatgaattttgtttcgttgataaaatccccgac
gcggtcacgatctaccggcggatcatcgaggattggcaggcaaatccagtctcaccaagt
tcgcgtttgaatgagctggaacaggtggcagcgaatgctcgcgcgactggaaaatcgaga
caatcgacatga

DBGET integrated database retrieval system