KEGG   Hyphomicrobium sp. MC1: HYPMC_2275Help
Entry
HYPMC_2275        CDS       T01557                                 

Definition
Tetrahydromethanopterin S-methyltransferase (EC:2.1.1.86)
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hmc01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:hmc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2149229..2150164)
Genome map
AA seq 311 aa AA seqDB search
MEILVSKPILSKYHTIKIGDVTIGGPLGSHTGLLVGSIFYDKHSLVSDAFAGAFDEAKAA
AIIEKVNGLSERYGVQMAFDVIAASPEAMEKFIEFVGGRTKLPFMINASEADVHIAGLEC
ADRLGVLNRAIFASLNEDTDDSIIEALGRHRPACVMILANDVGDPTPEGSCEMIERVFRP
MLNEIKVEAPLVDLGAMDPPSVGISIRGIEAVRRRFGYPAGCAFSNCFPQWTGLRDLGRE
WVNLSLATALVACRAAGGDFLHYGIIEKATMAAHVSGSAEVFYGFAAQELDGHTLPEGHA
LLRMFKLGATQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagatcttagtgtcgaagcccattctgtcaaagtatcacacgatcaagattggcgac
gtaacgatcggcgggccgctcggctcccacaccggcttactggtcggtagcatcttctac
gataagcattctctcgtgtccgacgcctttgctggcgcattcgacgaggctaaagccgcg
gcaattatcgaaaaggtcaacgggctttccgaacgctacggcgtgcaaatggcgttcgac
gtcatcgctgcttcgcccgaagcgatggagaaattcatcgagtttgttggtggccgaacc
aagctgccctttatgatcaacgcatcagaggctgacgtgcatatcgcgggcctcgaatgc
gcagatcgtcttggtgtccttaaccgagcgatctttgcttctctaaatgaagatactgac
gacagtattatcgaagcactcggccgccatcgcccagcgtgcgtgatgattctcgcgaat
gacgtcggagatccgacaccagaaggcagttgcgagatgatcgagcgtgttttcaggccg
atgctcaacgagatcaaagtcgaagcaccgctcgtcgatcttggtgcaatggatccacct
tcggtcggcatctcgataagaggaatagaggcggttcgacgtcgatttggttatccagcc
ggctgtgccttctctaattgctttccgcagtggacggggcttcgcgatcttgggcgcgaa
tgggtcaacctctcgctggcaacggcgcttgttgcctgtcgtgctgcgggtggagacttc
ctccattacggaattatcgaaaaggcgacgatggccgctcacgtctcgggctccgctgaa
gtcttctacggcttcgctgcgcaggaacttgacgggcacaccctgccggaggggcacgct
cttctcaggatgttcaaacttggagcaactcagtga

DBGET integrated database retrieval system