KEGG   Hyphomicrobium sp. MC1: HYPMC_2323Help
Entry
HYPMC_2323        CDS       T01557                                 

Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_2323
   00030 Pentose phosphate pathway
    HYPMC_2323
   00051 Fructose and mannose metabolism
    HYPMC_2323
   00052 Galactose metabolism
    HYPMC_2323
   00500 Starch and sucrose metabolism
    HYPMC_2323
   00520 Amino sugar and nucleotide sugar metabolism
    HYPMC_2323
  Nucleotide metabolism
   00230 Purine metabolism
    HYPMC_2323
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HYPMC_2323
Enzymes [BR:hmc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HYPMC_2323
    5.4.2.8  phosphomannomutase
     HYPMC_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2193232..2194737
Genome map
AA seq 501 aa AA seqDB search
MLPKPRADLKANTADFERLPLVKPTGFREYDARWLYPQEINLMGLNAVGLGMATLFARRG
VPKRIVVGHDYRSYSAAVKQALMTGLLAGGCEVHDIGLALSPMAYFAQFELDVEGVAMVT
ASHNDNGWTGIKMGLSRPLTFGPDDMSELKSIVLNGEFEAKTGGRYIFVSDLAERYTKAL
TNRPKLKRRLKVVAACGNGTAGAFAPQVLEAIGCEVVPLNTDLDYTFPNHNPNPEDMKML
HAVSAKVLETGADVGLAFDGDGDRCGVVANDGHEIFADKVGVMLARDISAIHKKAKFVVD
VKSTGLFTTDPVLIANGATTSYWKTGHSYIKRYNFEHKTLVGFEKSGHFFFNEPLGRGYD
DGLVSAIAVCDMLDRSPGKTVADLRDALPKTYGSPTMSPHCDDEKKYGVVDRITEHYTKQ
KESGGTIAGQAIRDLITVNGVRVMLEDGTWGLVRASSNKPELVVVVESPTSEANMKAIFK
DIDQQLSRFPEVGEYNQKIAV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgaagccacgcgctgacctgaaggccaacaccgccgacttcgagcgccttccg
ctcgtcaagccgaccggcttccgcgaatacgacgcgcgctggctctacccgcaggaaatc
aacctgatgggcctcaatgccgtcgggctcggcatggcgacgctgtttgcgcgccgaggc
gtgccgaaacgcatcgtcgtcggccacgactaccgctcgtactccgccgcggtgaagcag
gcgctgatgaccggcctgctcgccggcggatgcgaggtgcatgacatcggcctcgcgctg
tcgccgatggcctacttcgcgcagttcgaactcgacgtcgaaggcgtcgcaatggtgacg
gcaagccataacgataatggctggaccggcatcaagatgggattgtcgcggccgctgacg
ttcggacccgacgatatgtccgaattgaagtcgatcgttctcaacggtgagttcgaagcc
aagaccggcgggcgctatatcttcgtttccgatcttgccgagcgctataccaaggcgctg
accaatcgcccgaagctgaagcgccgcttgaaggtcgtcgcggcttgcggcaacggcact
gcgggcgcctttgcaccgcaagtgctggaagcgatcggctgcgaagtcgtgcccctcaac
accgatctcgactacaccttcccgaaccacaatccgaaccccgaagacatgaagatgctt
catgcggtctctgcaaaggttctcgaaaccggcgcggatgtcggcttggccttcgacggc
gacggcgaccgttgcggtgttgttgccaacgacggccatgaaatcttcgcggacaaggtc
ggcgtgatgctggcgcgcgatatttcggcgatccacaagaaggcaaagtttgttgtcgac
gtaaagtcgacgggcctgttcacgaccgatcccgtgctgatcgctaacggggcgacgacg
agctattggaagaccggccacagctacatcaagcgctataatttcgaacacaagacgctg
gtcgggttcgaaaagtcgggccacttcttcttcaatgagccgcttggccgcggctacgac
gatggcctcgtttcagcgattgccgtttgcgacatgctcgatcgcagtcctggaaaaacg
gttgccgatctgcgcgacgcgcttcccaaaacctacggctcgccgacgatgtcgccgcat
tgcgacgacgagaaaaagtacggcgtcgttgatcggatcaccgagcactatacgaaacag
aaagagagcggaggcacgattgcaggccaggcgatccgcgatctcatcaccgtcaacggc
gtgcgcgtgatgctggaagacgggacgtggggccttgtccgcgcatcatcgaataagccg
gagttggtcgttgtggtcgaaagcccgacctcggaagccaatatgaaggcgatcttcaag
gacatcgaccagcagctttcgcgcttccccgaagtcggcgaatacaatcagaagatagct
gtttaa

DBGET integrated database retrieval system