KEGG   Hyphomicrobium sp. MC1: HYPMC_2628Help
Entry
HYPMC_2628        CDS       T01557                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HYPMC_2628
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_2628
   00520 Amino sugar and nucleotide sugar metabolism
    HYPMC_2628
Enzymes [BR:hmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     HYPMC_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2469416..2470225
Genome map
AA seq 269 aa AA seqDB search
MMNVTVDKISIPKSDEIIKSPNILCVDIGGTLIKAATVNENGTLISDFITTQTPKPSTPE
TIVDLIVDVVKSLPAFGRVSVGFPGVVGRHHVKTAPNLGTPHWSEFDLEQTLTQRLNAPV
RVLNDAIVYGLGVAKGPGRECVLTFGTGMGCALFVNGSAFFGLELGQHHARDDINYDRYI
GHAAYLELGLEAWNERAKYVLSSVQGLTNVDRLYIGGGNSRRLTFDLPPWASVVPPSTGI
SGGARLWRPEMDQWFRQPSDLMGAASEQR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgttacggtagataaaatcagcattccgaaatcggatgagatcatcaaaagc
ccaaatattctgtgcgtcgatattggcggcacgctgatcaaagccgcgaccgtcaacgag
aatggcacgctgatctcggacttcatcacgacacagacgccaaagccgtcgacaccggaa
acgattgtcgatctcatcgtcgacgtcgtaaaatcgcttccggcttttgggcgtgtttcc
gtggggtttccgggtgtcgtcgggcgacatcacgtcaagaccgcgcccaatctcgggacg
ccgcattggagcgagttcgatctcgaacagacgctcactcagaggctcaatgcaccggtg
cgcgtgctcaacgatgccatcgtctacggccttggcgtcgccaaagggccaggccgcgaa
tgcgtcctgacgttcggcacgggtatgggatgtgcgctgttcgtcaacggctcggccttc
ttcgggctggagcttggacagcatcacgcgcgcgacgatatcaactacgatcgctacatc
ggacacgcggcctatcttgaactcggcctcgaagcttggaatgagcgtgccaagtatgtc
ttgagttccgtgcagggcctgacgaacgttgaccgcctttacatcggtggcggaaactcg
cggcgcctgacgttcgatcttccgccctgggctagcgtggtgccgccctccaccggcatt
tcgggcggcgcgcggttgtggcgtccggagatggatcaatggttccgacagccaagcgat
ctgatgggagccgcttcggaacagcgatga

DBGET integrated database retrieval system