KEGG   Hyphomicrobium sp. MC1: HYPMC_2710Help
Entry
HYPMC_2710        CDS       T01557                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hmc  Hyphomicrobium sp. MC1
Brite
Enzymes [BR:hmc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HYPMC_2710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2553459..2554112)
Genome map
AA seq 217 aa AA seqDB search
MTNTALQRKNMVESQIRPSDVTDRRITSAMTVIPREAFLPAKLADLAYSDESLMIAPGRE
VLAPRVLAKLIQLAEIEEADNVLVIGEAGYGAALVSQFAAKVVALLPDEESAKTAQAAFA
ANGITNAIAVSGPAAAGWSAKAPYDVVLVEGGIERVPEALKPQVREDGRLVAIATNDRIG
RAVEFHKRGGIFALREGFQASALPLAGFSVERPAFVF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaacactgctctgcaacgcaaaaatatggtcgaaagccaaatccgtccgagtgac
gtgacggacaggcgcatcacgtcggccatgacggtcattccgcgcgaagcctttctgccc
gcgaagctcgcagacttggcctatagcgacgaaagtttgatgatcgcgcccggacgcgag
gtgctggcgccgcgcgttctcgccaagctcattcaattggccgagatagaagaggccgat
aacgtcctcgtcatcggtgaagctggttatggcgcagcgctcgtctcgcagtttgcggcc
aaggtcgttgcactgctgcctgatgaggaaagcgccaagaccgctcaggccgcgttcgcg
gcgaacggcatcacgaacgctatcgcagtatctggcccggcagccgctggctggtcggcc
aaggcaccatatgatgtcgtcctcgtcgaaggtggcatcgagcgagtgcctgaggcgctg
aaaccgcaggttcgtgaggacggccgtttagtcgccatcgcaacgaatgaccggatcggc
agggctgtcgagtttcataagcggggaggaatcttcgctctgcgtgaggggttccaggcg
tcggctttgccgctggctggcttctcggtcgagcggcctgcttttgtattctag

DBGET integrated database retrieval system