KEGG   Hyphomicrobium sp. MC1: HYPMC_4008Help
Entry
HYPMC_4008        CDS       T01557                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hmc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3853910..3855334
Genome map
AA seq 474 aa AA seqDB search
MRVAAIDQGTTSTRVLVADTDGKLEIASSVTHQQFHPHPGWVEHDPEELLTNIRRCLDAA
GKVDAIGIDNQGESCLAWDAETGAALSPVIVWQDNRTADAVGRLKDKGAASLTLSRAGLP
LDAYFSASKLSWIVANIPAAKDALAAGRLRLGTTDAFFLDRLAGTFATDVTTASRTSLMD
LETGKWDADLCELFGVPISALPEIRPTVADFGRINGVPITASVVDQQAALFGHGCREPGD
AKITFGTGAFALAVTGKEIAHAPEKGLLPTVAWSINGTMTYAVDGGVYDAGSAVEWARRI
GLIADIEKDLEWFDAEPAIDRDVVFVPALSGLACPHWDRTAASLFVGMSAATTQADMQQA
LLEGIALSAADVIAAMHAHVPIGGSIAIDGGLARSRYFAQFLADMIGREVIVADFDERTA
FGTAKLAALGAGISLPDAKSTAQSFHPRIADSSATRRRFHDAVARCKSWRDLGE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtagccgcgatcgaccaaggaacaacgtcgacacgtgtgctggtcgccgacacg
gatgggaaacttgagattgcgtcctcggtgacgcatcagcaattccatccgcatcccggt
tgggtcgagcacgatccggaagagctgctgacaaacatccggcgctgtctcgatgcggca
ggcaaagtcgatgcgatcggaatcgacaatcaaggcgaaagctgccttgcctgggatgcc
gaaaccggcgcggcgttgtcacccgttattgtatggcaggacaatcgcaccgccgatgcc
gtcgggcgcttgaaagataaaggcgcggcgtcactgacactctcgcgtgcggggttgccg
ctcgacgcctatttttctgcatccaagctctcctggatcgtcgccaatatcccggcggcg
aaggatgccctggcggcgggacgtttgcggctcggcacgacggatgctttctttcttgat
cgcctcgctggaactttcgcgaccgacgtgacgacggcatcgcggacgtcgttgatggac
ctcgaaaccggcaagtgggacgccgatctttgcgagctgttcggcgtaccgatctcggcg
ttgccggagataagaccgacggtcgccgatttcggccggatcaacggcgtgcccatcacc
gcttcggtcgttgatcagcaggctgcacttttcggtcatggttgccgtgagccgggagat
gcaaagatcacattcgggacgggggcgttcgcgctggccgtgacgggcaaagagatcgct
catgcgccggaaaagggactattgccgaccgtcgcctggtctatcaatgggacaatgacc
tatgcggtcgacggcggcgtttacgatgctggttcggcggtcgagtgggcgcggcgtatc
ggactgatcgcagacatcgagaaggatctcgaatggttcgacgccgagccggccatcgac
cgtgacgtcgtgttcgttcctgcgctttcaggactggcttgcccgcactgggaccggacg
gcggcgtcgttgtttgtgggcatgtcggcggcaacgacacaggcagacatgcagcaggcg
ctgctcgaaggtatcgccttgagcgctgcagatgtcatcgcagccatgcacgcgcacgtc
ccgatcggtggatctattgcaatcgacggcggccttgcgcgcagccggtattttgcacaa
ttcctggccgacatgatcgggcgcgaggttatcgtcgcggatttcgatgagcgcacagcg
ttcggaacggctaagctcgcggcgctcggcgccggcatatcgctgccggatgccaagagc
accgctcaaagcttccatccccgaattgccgatagctcggcgacgcgccggcgttttcat
gacgcagttgcgcgctgcaagagttggcgcgatctcggcgaataa

DBGET integrated database retrieval system