KEGG   Hyphomicrobium sp. MC1: HYPMC_4040Help
Entry
HYPMC_4040        CDS       T01557                                 

Definition
(GenBank) putative Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00010  Glycolysis / Gluconeogenesis
hmc00071  Fatty acid degradation
hmc00350  Tyrosine metabolism
hmc00625  Chloroalkane and chloroalkene degradation
hmc00626  Naphthalene degradation
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01130  Biosynthesis of antibiotics
hmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_4040
  Lipid metabolism
   00071 Fatty acid degradation
    HYPMC_4040
  Amino acid metabolism
   00350 Tyrosine metabolism
    HYPMC_4040
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HYPMC_4040
   00626 Naphthalene degradation
    HYPMC_4040
Enzymes [BR:hmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HYPMC_4040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 POR
Motif
Other DBs
NCBI-ProteinID: CCB67249
UniProt: F8J7D6
Position
3888174..3889247
Genome map
AA seq 357 aa AA seqDB search
MTASRAIDAHAIVAAALRPSPNSDPKDNPPMKAMVFRAVGEPLTLEERPDPQPGKGEIRV
RVEACAVCRTDLHVIDGDLPDPKHPVIPGHEIVGIVDALGADVHDHKIGERVGVPWLGHT
CGHCPYCLAERENLCDFPLFTGYTRDGGFATHVIADADFAFAMPGFSDPVAAAPLMCAGL
IGWRSLRMAGDGKRIGLYGFGAAAHIIAQVIIWQGREVYAFTRAGDNQAQDFARSLGAVW
AGSSDDVPPNELDAAIIFAPVGSLVPAALKAVRKGGRVVCGGIHMSDIPQFPYDILWEER
EIRSVANLTRQDAHEFLDIAPKAGVHTTTTVYPLAHANEALADLRAGRFSGAAVLVP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcgagccgcgcgattgatgcccatgcgatagtcgcggcagcgttgcgaccatct
cctaattcggatccgaaagataatccgccgatgaaagccatggtcttccgagccgtcgga
gagcctctgaccctcgaagaaagacctgatccgcagccgggaaaaggcgaaatccgcgtt
cgcgtcgaagcgtgcgcggtctgccggacggacctgcacgtcatcgatggcgatcttccc
gatcccaagcatcccgttattccagggcacgagatcgtcggcatcgtcgatgcacttggc
gcagacgttcacgaccacaaaatcggcgagcgcgtcggcgtgccgtggctcggccatacg
tgcgggcactgtccctattgcctcgcggagcgcgagaacctgtgcgactttccgcttttc
accgggtacacgcgtgacggcggattcgccacgcatgtgatcgccgatgcggacttcgcc
tttgcgatgccgggtttcagcgatcccgtggcggcagcgccgctgatgtgcgctggcctt
atcggctggcggtctttgcgcatggcgggcgacggcaagcgtatcggactctatggattt
ggcgcggcggcgcacatcatcgcgcaggtcatcatctggcagggacgcgaggtttacgca
ttcacgagagcgggcgacaaccaagcgcaggacttcgcgcgctcgctcggtgcggtatgg
gccggcagctcagacgatgtgccgcccaacgaactggacgccgcaattatttttgcgcct
gtgggcagcctcgttccagcggcactcaaggcggtccgcaaaggcggccgcgtcgtctgc
ggcggcattcacatgagcgacattccgcagtttccctacgatattctatgggaagagcgg
gagatccggtcggtggccaatctcacgcgccaggatgcgcacgagtttctcgacatcgcg
ccgaaggccggggtccatacgacgacgaccgtctatccgctcgctcacgccaatgaagcg
cttgccgacttgcgggccggacgtttctccggcgccgccgttcttgttccctga

DBGET integrated database retrieval system