KEGG   Hyphomicrobium sp. MC1: HYPMC_4040Help
Entry
HYPMC_4040        CDS       T01557                                 

Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HYPMC_4040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPMC_4040
  Lipid metabolism
   00071 Fatty acid degradation
    HYPMC_4040
  Amino acid metabolism
   00350 Tyrosine metabolism
    HYPMC_4040
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HYPMC_4040
   00626 Naphthalene degradation
    HYPMC_4040
Enzymes [BR:hmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HYPMC_4040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3888174..3889247
Genome map
AA seq 357 aa AA seqDB search
MTASRAIDAHAIVAAALRPSPNSDPKDNPPMKAMVFRAVGEPLTLEERPDPQPGKGEIRV
RVEACAVCRTDLHVIDGDLPDPKHPVIPGHEIVGIVDALGADVHDHKIGERVGVPWLGHT
CGHCPYCLAERENLCDFPLFTGYTRDGGFATHVIADADFAFAMPGFSDPVAAAPLMCAGL
IGWRSLRMAGDGKRIGLYGFGAAAHIIAQVIIWQGREVYAFTRAGDNQAQDFARSLGAVW
AGSSDDVPPNELDAAIIFAPVGSLVPAALKAVRKGGRVVCGGIHMSDIPQFPYDILWEER
EIRSVANLTRQDAHEFLDIAPKAGVHTTTTVYPLAHANEALADLRAGRFSGAAVLVP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcgagccgcgcgattgatgcccatgcgatagtcgcggcagcgttgcgaccatct
cctaattcggatccgaaagataatccgccgatgaaagccatggtcttccgagccgtcgga
gagcctctgaccctcgaagaaagacctgatccgcagccgggaaaaggcgaaatccgcgtt
cgcgtcgaagcgtgcgcggtctgccggacggacctgcacgtcatcgatggcgatcttccc
gatcccaagcatcccgttattccagggcacgagatcgtcggcatcgtcgatgcacttggc
gcagacgttcacgaccacaaaatcggcgagcgcgtcggcgtgccgtggctcggccatacg
tgcgggcactgtccctattgcctcgcggagcgcgagaacctgtgcgactttccgcttttc
accgggtacacgcgtgacggcggattcgccacgcatgtgatcgccgatgcggacttcgcc
tttgcgatgccgggtttcagcgatcccgtggcggcagcgccgctgatgtgcgctggcctt
atcggctggcggtctttgcgcatggcgggcgacggcaagcgtatcggactctatggattt
ggcgcggcggcgcacatcatcgcgcaggtcatcatctggcagggacgcgaggtttacgca
ttcacgagagcgggcgacaaccaagcgcaggacttcgcgcgctcgctcggtgcggtatgg
gccggcagctcagacgatgtgccgcccaacgaactggacgccgcaattatttttgcgcct
gtgggcagcctcgttccagcggcactcaaggcggtccgcaaaggcggccgcgtcgtctgc
ggcggcattcacatgagcgacattccgcagtttccctacgatattctatgggaagagcgg
gagatccggtcggtggccaatctcacgcgccaggatgcgcacgagtttctcgacatcgcg
ccgaaggccggggtccatacgacgacgaccgtctatccgctcgctcacgccaatgaagcg
cttgccgacttgcgggccggacgtttctccggcgccgccgttcttgttccctga

DBGET integrated database retrieval system