KEGG   Hyphomicrobium sp. MC1: HYPMC_4178Help
Entry
HYPMC_4178        CDS       T01557                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00260  Glycine, serine and threonine metabolism
hmc00750  Vitamin B6 metabolism
hmc01100  Metabolic pathways
hmc01110  Biosynthesis of secondary metabolites
hmc01120  Microbial metabolism in diverse environments
hmc01230  Biosynthesis of amino acids
Module
hmc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HYPMC_4178 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HYPMC_4178 (thrC)
Enzymes [BR:hmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HYPMC_4178 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CCB67387
UniProt: F8J972
Position
complement(4033847..4035262)
Genome map
AA seq 471 aa AA seqDB search
MRDNLNYISTRGEVEKLGFEDVVLAGLARDGGLYVPEVWPVLSSETITFFAGKSFAEIAV
EVIHPFTGDEISRDDLFRMASEAYATFASDEVTPLHAVKPGLTILELFHGPTLAFKDVAM
QLLSRLMDHVLAKRSRRATIVGATSGDTGGAAIEAFRSSKRVDVVILFPEGRVSDVQRRM
MTTPSEKNVHALAIRGTFDDCQALVKAMFNDHAFRDRVELSGVNSINWARIVAQVTYYFY
AASRLGGGSNGALSFAVPTGNFGDIFAGYVAKRMGLPIAKLIIASNENDILPRAVSTGVY
AMRDVIATSSPSMDIQISSNFERYLFEASGRDADLVRSLMTSLAAKGSFELGRVAPILQA
DFAAVSATEQDVADCIRETETRYGYLLDPHTACAFVAAERTSAGDTVVLSTAHPAKFPDA
IERITGKRPPLPPGFEHLMTDDEHFEVLPNSLAAVEEFVLNHSRAAPGVSR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagagataatttgaactacatttcaacgcgcggcgaagtcgaaaaactgggatttgag
gacgttgtcctcgcgggacttgctcgcgacggcggcctttacgtgccggaagtctggccg
gtcctttcttccgaaacgatcacgttcttcgccggaaaatccttcgccgaaatcgcggtc
gaggtcattcatccgttcaccggcgatgagatctcccgcgacgatctctttcgcatggcg
agcgaggcttacgccacattcgcgagcgatgaagtcacgccgctgcatgccgtgaagccc
ggcttgacgatcctcgaactgttccacggcccgacgctcgccttcaaggacgtcgcgatg
cagttgctctcgcgcctgatggatcacgtgctggcgaagcgcagccgccgcgcgacgatc
gtcggcgcgacgtccggcgataccggcggcgccgcgattgaagccttcagaagctcgaag
cgcgttgacgtcgtcatcctgtttcccgaaggccgtgtctccgacgtccagcgccggatg
atgacgacgccttcagagaaaaacgtccacgcgctcgccatccgcggcacgttcgacgac
tgccaggcgctcgtcaaagcgatgttcaacgatcacgccttccgcgatcgcgtcgagctg
tcgggcgtcaattcgataaattgggcacgcatcgtcgcacaggtgacgtattacttttat
gccgcttcgcgccttggcggcggttcgaacggcgcgctgtcgttcgcggtgccgaccgga
aacttcggcgatatctttgccggctacgtcgccaagcgcatgggcttgccgatcgcaaag
ctcatcattgcctccaacgaaaacgatattctgccgcgcgccgtctcgaccggcgtctac
gccatgcgcgacgtcatcgcgacgtcctcgccgtcgatggacattcagatttcctcgaat
ttcgaacgctatctgttcgaagcctcaggtcgcgacgccgacttggtccgcagcctgatg
acctctttggccgccaaaggctctttcgagctggggcgcgtcgccccaattttgcaggct
gatttcgccgccgtctccgcgactgagcaggacgtggccgattgcatccgcgagacggaa
acgcgctacggctatctgctcgatccccataccgcctgcgccttcgttgccgccgaacgc
acgagcgcgggcgacaccgtcgttctctcgacggcgcaccccgccaaatttcccgacgcc
atcgaacggatcaccggcaagcggccgccgctgccgcccggctttgagcatttgatgacc
gacgacgaacatttcgaagtcttgccgaacagcctcgcggcggtcgaagagttcgttctg
aaccacagccgcgctgcgccgggggtatcgcgatga

DBGET integrated database retrieval system