KEGG   Hyphomicrobium sp. MC1: HYPMC_4284Help
Entry
HYPMC_4284        CDS       T01557                                 

Gene name
phaA
Definition
(GenBank) beta-ketothiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HYPMC_4284 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    HYPMC_4284 (phaA)
   00640 Propanoate metabolism
    HYPMC_4284 (phaA)
   00650 Butanoate metabolism
    HYPMC_4284 (phaA)
  Lipid metabolism
   00071 Fatty acid degradation
    HYPMC_4284 (phaA)
   00072 Synthesis and degradation of ketone bodies
    HYPMC_4284 (phaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HYPMC_4284 (phaA)
   00310 Lysine degradation
    HYPMC_4284 (phaA)
   00380 Tryptophan metabolism
    HYPMC_4284 (phaA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HYPMC_4284 (phaA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HYPMC_4284 (phaA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HYPMC_4284 (phaA)
Enzymes [BR:hmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HYPMC_4284 (phaA)
Exosome [BR:hmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HYPMC_4284 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4116202..4117392
Genome map
AA seq 396 aa AA seqDB search
MRQDPIVIVSAVRTPLGRFLGDLAPLQASELGAHAIRAALERAKLAPEKVDEVLFGNVLT
AGQGQAPARQAARAAGLPDATGATTVNKVCGSGMKATFLAHDLLAAGSADIVVSGGMESM
SNAPYLLQRARAGFRVGHGQVLDHMLLDGLEDAYEKGRSMGDFGEATAEAYQFTRADQDA
FAVETLTRARSAIQSGAFKAEIAPIRIATKEGEKVVVDDENPLKVSPEKVPKLKPAFRPN
GTITAASSSANADGAAALVLTRRSLAERERLPILAEIRAHATHSQEPAWFTTAPIPAIRK
ALAKAGWEAGDVDLYEINEAFAAVAMAAQKDLSIARDKLNVNGGACALGHPIGATGARLI
VTLLHALERQGATKGIASACIGGGEATAIAIERVGH
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggacccgattgtcatcgtatctgcggttaggacgcctctcgggcggtttctg
ggcgatcttgccccgctccaggcttcggaactcggcgcgcacgccatccgggccgcactg
gaacgggctaagctggcgccagagaaagtggacgaggttcttttcggtaatgtgctgacg
gcgggacaggggcaggcgccggcacggcaggccgcacgcgctgccggactgcccgatgcg
acgggtgcgacgaccgtaaacaaggtttgtgggtcaggcatgaaagccacgtttctcgcc
cacgatctgctcgccgcgggctcggctgatatcgtcgtctcgggcggcatggaatcgatg
tcgaacgcgccgtatctgctgcagagggcccgtgcgggttttcgcgtcgggcacggacag
gtgctcgatcacatgctactcgacggcctcgaagatgcttacgaaaaaggccgcagcatg
ggcgatttcggcgaggcaacggctgaggcctatcagttcacgcgggcggatcaggatgcg
ttcgcagtcgagacactgacgcgcgcgcgctccgctattcagtccggagcattcaaagcc
gagattgctccgatccgcatcgcgaccaaagagggcgagaaggtcgtggtcgatgacgag
aacccgctcaaggtctcaccggagaaagttccgaagctgaaaccagcgttccggccgaac
ggcacgataaccgcggccagctcgtcggcaaacgccgatggggcggcagctctggttcta
acgcgccgctcgcttgcagagcgcgaaagactaccgattcttgcagagatccgcgcacac
gccacgcacagtcaggagccggcctggttcacgaccgcgccaattcccgccattcgcaaa
gccttggcaaaggcggggtgggaggctggggacgtcgatctttacgagatcaatgaagcg
ttcgcggcggtcgcgatggccgcgcagaaggatctttcgatcgcgcgcgataagctcaac
gtcaatggcggcgcgtgtgcactcggacacccgatcggtgcaacgggcgcgcggttgatc
gtgactctgctgcacgcgcttgagcggcagggagcgacgaaagggatcgcgtcggcttgt
atcggcggtggcgaagcgaccgcaatcgctatcgagcgcgttgggcattga

DBGET integrated database retrieval system