KEGG   Hyphomicrobium sp. MC1: HYPMC_4316Help
Entry
HYPMC_4316        CDS       T01557                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
hmc  Hyphomicrobium sp. MC1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4148574..4149683)
Genome map
AA seq 369 aa AA seqDB search
MSTFALRQLPSSAAFMLASLAAIACTFLVWNISMRSEGDLASLLSWSDVSWQIAEVDARG
RIVRLGAHPFGLALLFGLVTACCMSFAWGAWKFIDRRPTQREADEGLSDRLEKVGKELDD
EMSSVMRLLKQHLDLSGSHSESLTKAADGLVSSTSPDGIRAIIQYLISENKKVQTEVNEL
NNRLQQSQLQIDKLRVSLSDSHRLGMLDAVTSLKNRHWLDVHLPKEVEAASHAKEPLSII
MADVDHFKRINDTFGHAVGDEILRRFAELLSKNIKGRDTAARYGGEEFIVVLPQTRLAGA
RNLGEQMRGELESKKWMHHRTGQPIGKVTASFGIAELRQGEEYDDFLDRADSKLYEAKAA
GRNRVVVDD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatttgcactccggcagctaccgtcctccgcggctttcatgttggcaagcctt
gcggccatcgcctgcacgtttctcgtgtggaacatctcgatgcgctccgagggcgattta
gcatcgcttctgagctggtccgatgtttcctggcaaatagccgaggtcgatgcaagaggt
cgtatcgttcgtcttggagcccatcctttcggactggcacttcttttcggcctcgtcacg
gcctgctgcatgagcttcgcttggggcgcctggaagttcatcgatcgcaggcctacgcaa
cgagaggcggacgagggcctctcggaccggctcgaaaaagtcggcaaagaactcgacgac
gaaatgtcgtccgtgatgcgcctcttgaagcagcatctggatttgagcggatctcattcg
gaatcgttgacgaaagctgctgatggtctcgtctcttcgacgtcgccagatggtatccgg
gcgatcatccagtacctcatcagcgaaaacaaaaaggtgcagaccgaggtcaacgagctg
aacaaccgtcttcagcagtcgcagctgcaaattgataagctacgcgtcagcctgagtgac
agccatcgattaggcatgttggacgctgtgacgtcactgaagaacaggcactggctggat
gtccatcttcctaaagaagtggaagcggcgtcgcacgccaaggaaccgctcagcatcatc
atggccgacgtcgatcacttcaaacgcatcaatgacacgttcggccacgccgtcggcgac
gagatcctgcggcgcttcgcggaactcctctccaagaatatcaagggcagagacacggcg
gcccggtatggtggtgaagaattcatcgtcgttctgccccaaacgcggctcgcgggcgcc
agaaatctcggcgagcaaatgcgcggtgaactcgagtctaagaaatggatgcatcatcgc
acggggcagccaatcgggaaggtgacggcatcgttcggcatcgccgaattgcggcaaggc
gaagaatacgacgatttccttgatcgcgcagattccaaattgtacgaagcgaaagctgca
ggacgtaatcgtgttgtcgtcgacgactaa

DBGET integrated database retrieval system