KEGG   Hyphomicrobium sp. MC1: HYPMC_4573Help
Entry
HYPMC_4573        CDS       T01557                                 

Definition
acyl-CoA thioesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HYPMC_4573
Enzymes [BR:hmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HYPMC_4573
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HYPMC_4573
Lipid biosynthesis proteins [BR:hmc01004]
 Fatty acid synthase
  Component type
   HYPMC_4573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4400954..4401694)
Genome map
AA seq 246 aa AA seqDB search
MCDVWGRKMNAKASRAPIRVSGWIAKIAFRVMICAGMMAPLVTSATAVSSRPLTIVAFGD
SLTAGYGVKTSDSFPAQLQMALQAKGHKVTVTNAGVSGDTTSGGLERLDWALDPKPDAVI
MELGANDALRGIDPKVPRENLDKMLADLKAKGIPVLLTGMKAPNNWGDDYAKKFDAIFPD
LAKKYDVPLYPFFLEGVALDPSFTQPDGLHPTAKGVAEIVKRILPDVEALIARIEQSETT
AKGAAP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgtgtggggccgaaagatgaacgctaaagcttcccgcgccccaattcgggtt
tctggctggattgcgaagatcgcctttcgcgtgatgatctgtgccgggatgatggctccg
ctcgtaacctctgcaactgccgtgtcgtcgcgcccgctgacgatcgtcgccttcggcgac
agtctgacggccggttacggcgtcaaaaccagcgactccttcccggcccagcttcagatg
gcgcttcaggccaaaggacacaaggtcaccgtaacgaatgccggcgtttcgggcgatacg
acgtcgggcggactggaacgcctcgactgggcgctcgatcccaaacccgacgcggtcatc
atggagcttggcgccaacgacgcgctgcgcggtatcgacccgaaagtcccgcgcgaaaac
ctcgacaagatgctggccgatctcaaagccaaaggcattcccgttctgctcaccggcatg
aaagcgccgaacaattggggcgacgattacgccaaaaaattcgatgcgatctttccggat
ctcgcaaaaaaatacgacgttccgctctatccgttttttctcgaaggcgtcgcgctcgat
ccctcatttacgcaacccgatggtctgcatccaacggccaaaggcgttgccgaaatcgtg
aaacgcattctgcctgacgtcgaagcgcttatcgcgcgcatcgagcaaagtgagacaaca
gcaaaaggggccgcgccttaa

DBGET integrated database retrieval system