KEGG   Hyphomicrobium sp. MC1: HYPMC_4599Help
Entry
HYPMC_4599        CDS       T01557                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HYPMC_4599
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HYPMC_4599
   00650 Butanoate metabolism
    HYPMC_4599
  Energy metabolism
   00190 Oxidative phosphorylation
    HYPMC_4599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4424947..4425330
Genome map
AA seq 127 aa AA seqDB search
MTTMRTPLKKVRYLGSAKEGADHFWTQRVTAVANLFLGIFLVWLIVSLLGADYATAKQKL
AHPLIAIPLLGLVLSGTVHMRIGMQVIIEDYVHEEGLKVVALMLNTFFAIAIALACVFSI
LKLSFGA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatgcggacaccgctgaaaaaagtacgttatctcggctcggccaaagaaggc
gccgaccatttctggacacagcgcgtgacggcggtcgcgaacctgttcctcgggatcttt
ctcgtttggctgatcgtttcgctgcttggcgcggactacgcgacggcgaaacagaagctt
gcgcacccattgattgcgattccgcttctcggtcttgtactttctggcaccgtgcatatg
cggatcggcatgcaagtcatcatcgaagattacgtacacgaagaagggcttaaggtggtg
gccttgatgctcaacaccttcttcgccattgccatcgcactcgcgtgcgtgttctcgatt
ttgaaactgagttttggagcctga

DBGET integrated database retrieval system