KEGG   Hyphomicrobium sp. MC1: HYPMC_4842Help
Entry
HYPMC_4842        CDS       T01557                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hmc  Hyphomicrobium sp. MC1
Brite
Enzymes [BR:hmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     HYPMC_4842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4647347..4648252)
Genome map
AA seq 301 aa AA seqDB search
MSAAISPLPTTPPHETTPTKTTFRIAGGRTGVLLIHGLCGTPAEMRFVALGLARAGYTVH
CPTLAGHGGTRADIVATTWRDWLRSAESALEELRRECETVIVGGLCLGSIIALHLAADHP
EKVQGVALFSPTFQVNGWAMPWYSRLFSLVRSRRIANMMQFPDAESLGIKCPRVRDFVRA
ALAASDGSALGTVGTPGAALYEHRRLVSAVKKRIGKICQPALIVHSREDDYADLKNATYL
QTALHGAPELLVLDDSYHMVTLDRQRHLVVEKTRAFIARIMADQAAGAGESNSVPLPTKA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagccatctcaccacttccgacgacgccaccccacgaaaccaccccgacaaaa
accacgtttcggatcgcaggcggccgtacgggcgtactgctgattcacggcctctgtggc
acccctgctgaaatgcgcttcgtcgcccttggtctcgcccgcgccggctacaccgtacac
tgcccgacactcgccggacacggcggcacgcgcgccgatatcgtcgcaacgacgtggcgc
gattggcttcgcagcgccgaatccgccctcgaagagctgcgccgggaatgtgagactgtt
atcgttggcgggctctgccttggcagcatcattgcgctacatctcgcggcagaccatccg
gaaaaagtgcaaggcgtcgcgcttttctcgccgacgtttcaggtgaacggctgggcaatg
ccctggtacagccgattgttctcgctcgtgcgcagccgccgcatcgccaacatgatgcaa
tttcccgacgccgagtctctcggcatcaaatgcccccgcgttcgcgatttcgtccgcgct
gctcttgcagcgtccgacggctcagccctcggcactgttggaacgccgggtgccgcactc
tacgaacaccgccgcctcgtatcggctgtgaaaaaaagaattggaaaaatttgtcagcct
gcgttgatcgtgcattcccgcgaagacgactacgccgatctcaaaaatgcgacgtacctt
cagacggctctgcatggcgcccccgaacttctcgtcctcgacgatagctaccacatggtc
acgctcgaccggcagcgtcatctcgtggtggaaaaaacacgcgccttcatcgcacgcatc
atggcggatcaggcagccggcgcaggtgaaagcaactcagttcctctgcccaccaaagcc
gcatag

DBGET integrated database retrieval system