KEGG   Hyphomicrobium sp. MC1: HYPMC_4921Help
Entry
HYPMC_4921        CDS       T01557                                 

Definition
glycoside hydrolase 5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hmc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4729606..4730616)
Genome map
AA seq 336 aa AA seqDB search
MKFQIQKVWRTALVVIACLSASPAIADSKAAWMTGVNLSGAELNAKKSRINFDYVFPTIK
EIEYFRAKGFRYFRLPVLMQRLFQFEGGVPDPTPTADWKQFVALIDKAASVDAVIIVDFH
QFGRTQSGLIGRDAAATQEFVAAWAETAKRLKDKPNVIFNLMNEPHEQTAEEWLPAANTA
IAAIRQAGAKQLLLVPGSYWTGAHSWTTTPNARVMTGVVDPENNFAYDVHQYLDSNSSGT
SPDAVPGSGSERLKAFTEWARQNHAHGFLGEFGFSSAEPALREGAALIKYMSDNRDVWIG
WTYWAAGPWWGDYMYSVEPKNGTDRPQLDVLVQGNK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcagattcaaaaagtctggcgcaccgcgctggtcgtgatcgcctgcctctcg
gcctcgcctgcaattgcggacagcaaagcggcgtggatgactggcgtcaatctgtcgggc
gccgaactcaacgcaaagaagagccggatcaatttcgactacgttttcccgacgatcaaa
gagatcgaatacttccgcgccaagggctttcgctatttccgcctgccggtgttgatgcag
agactgttccaattcgaaggcggcgttccggacccgacgccgacggcagactggaagcaa
ttcgtcgcgttgatcgacaaggccgccagcgtcgacgcagtgatcatcgtcgactttcat
cagttcggccgaacgcaatccggcctcatcggacgcgacgcggccgcaacgcaggagttc
gttgcggcatgggctgagacggcgaagcggctcaaagacaagcccaacgtcattttcaat
ctcatgaacgagccgcacgagcagacggcggaggagtggcttccggccgcgaacaccgcg
attgccgccatccgccaagccggcgccaagcaactgctgctggtgccgggctcctactgg
accggcgcgcattcgtggaccacgacccctaacgcgcgcgtcatgaccggagtcgtcgat
ccggagaacaacttcgcctatgacgttcatcaatatctcgactccaacagttccggcacg
tcgccggacgccgtccccggatcgggaagcgaacggctcaaggccttcaccgaatgggcc
cgtcagaatcacgcgcacggctttcttggcgaattcggtttttcgtccgccgaacctgct
cttcgcgagggcgccgcgctgatcaagtatatgtccgacaaccgggacgtctggatcgga
tggacgtattgggcggctggcccctggtggggcgattacatgtattccgtcgaacccaag
aacggaaccgaccgccctcagcttgatgttctcgtgcaggggaacaagtag

DBGET integrated database retrieval system