KEGG   Hyphomicrobium sp. MC1: HYPMC_4927Help
Entry
HYPMC_4927        CDS       T01557                                 

Definition
(GenBank) Cytochrome c class I
  KO
K08738  cytochrome c
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HYPMC_4927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CCB68135
UniProt: F8JH86
Position
4735724..4736164
Genome map
AA seq 146 aa AA seqDB search
MKKIPLLPRSLHSAIVLSALALGIGLVGTTASVVAHADDDDPELAFNGHCRECHAFDKGD
NRIGPTLYGVVGRKAGTVPGFDYSESLKDSGITWNEQNLDQWIANPNAVVPGNNMGAIFS
GLPDKKQRALIIKFLASDTKKKTGGN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattccgcttctcccccgctcgcttcactccgccatcgttctttcggcttta
gccttgggtatcggtctggtcggcacaacagcgtcggtcgtcgctcatgccgacgatgac
gatcccgaacttgctttcaacggacattgtcgcgaatgtcacgccttcgataagggcgac
aatcgtatcggtcccacactctatggtgtcgtcggccgcaaggccggcaccgttccaggt
tttgattattcggaatctctcaaagactcgggcatcacttggaacgagcaaaatctcgac
cagtggattgccaatccgaatgcggtcgttcccggcaacaatatgggcgcaatcttcagc
ggcttgcccgacaagaaacaacgcgcgctgatcattaagtttttggcgagcgacaccaag
aaaaagacgggcggcaattaa

DBGET integrated database retrieval system