KEGG   Hyphomicrobium sp. MC1: HYPMC_4947Help
Entry
HYPMC_4947        CDS       T01557                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hmc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4753636..4754514
Genome map
AA seq 292 aa AA seqDB search
MPELPEVETVRRGLAPVLVGSRVARIDARRPDLRFPLPERFGERLAGQDIVGLERRAKYL
IATLSSGEDLVMHLGMTGRFSVIHKDFIDRPGDYIHDTGPDPAHDHVVLHLSDGTQVIYN
DPRRFGFMVMMPHAERPEHALFRKLGAEPLSAELTAEYLARRALGKKVNLKAFLMDQHIV
AGLGNIYVSEALFQAGLSPDRVAATLANRRGGIEKAEKLVVAIKDVLQRAIAAGGSTLRD
YRSADGKKGAFQERFAVYDREGGMCPTPGCGGEIRRAVHAGRATFYCRRCQR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactccccgaggtcgaaaccgtgcggcgggggctggcgccggtgctggtcggc
agccgggtcgcgcggattgacgcgcggcggccggatttgcgttttccgctgccggaacgg
ttcggcgagcggctggcggggcaagacatcgtcgggctggagcggcgcgcgaaatatctg
attgcgacgctttcgagcggcgaggatctcgtcatgcatctgggcatgaccggacggttt
tccgtcatccataaggacttcatcgaccggccgggggactacatccacgatacggggcct
gatccggcgcacgatcatgttgtgctgcatctctctgacgggacgcaggtgatctacaac
gatcccaggcggttcggattcatggtcatgatgccgcatgcggagcggccggagcatgcg
ctgtttcgcaagctcggggcggagccattgagcgccgaactgacagccgaatatctggcg
cgacgcgcgctgggcaagaaggtcaacctcaaagcgtttctgatggaccagcacatcgtg
gcggggctcggcaacatctacgtgtctgaggcgctgtttcaggcggggctatcgcccgat
cgtgttgcggcaacgttggcgaaccgtcgcggaggcatcgagaaggccgagaagctcgtc
gttgcgatcaaggatgttctgcaacgggccattgcagcgggcggttcgacgctgcgcgat
taccgcagtgccgacggcaagaagggagcattccaggaacggtttgccgtttacgaccgg
gaaggcggcatgtgtcccactcctggatgcggcggcgaaatccgccgcgcggtgcatgcc
gggcgcgcgacgttttattgccggcggtgtcagcgctga

DBGET integrated database retrieval system